1J7M: Matrix metalloproteinase 2

The Third Fibronectin Type II Module from Human Matrix Metalloproteinase 2. Determined by solution NMR. Released 30 May 2001.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 451
Mol. weight: 7.75 kDa
Released: 30 May 2001

Explore 1J7M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1J7M contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	1
α-helix	13-15	3
β-strand	19-21	3	2
β-strand	24-26	3	2
β-strand	30	1	1
β-strand	40-42	3	1
β-strand	46	1	2
α-helix	47-50	4
β-strand	53-55	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Matrix metalloproteinase 2	A	protein	72	Homo sapiens	P08253 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1J7M_1 MATRIX METALLOPROTEINASE 2 (chains A)
LAAHPPFASWMSTVGGNSGGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRK
WGFCPDQGWISS

Primary citation

Gelatin-binding region of human matrix metalloproteinase-2: solution structure, dynamics, and function of the COL-23 two-domain construct. Briknarova, K., Gehrmann, M., Banyai, L. et al. J Biol Chem (2001) 276:27613-27621. DOI 10.1074/jbc.M101105200 · PubMed

Other PDB entries of the same protein (UniProt P08253 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AYU 2.0 Å, Crystal structure of MMP-2 active site mutant in complex with APP-drived decapeptide…
7XJO 2.0 Å, Crystal structure of human MMP-2 catalytic domain in complex with inhibitor
1GEN 2.15 Å, C-terminal domain of gelatinase a
8H78 2.4 Å, Crystal structure of human MMP-2 catalytic domain in complex with inhibitor
1RTG 2.6 Å, C-terminal domain (haemopexin-like domain) of human matrix metalloproteinase-2
1EAK 2.66 Å, Catalytic domain of proMMP-2 E404Q mutant
1CK7 2.8 Å, Gelatinase a (full-length)
1QIB 2.8 Å, Crystal structure of gelatinase a catalytic domain
7XGJ 2.8 Å, Crystal structure of human MMP-2 catalytic domain in complex with inhibitor
1GXD 3.1 Å, proMMP-2/TIMP-2 complex
1CXW The second type II module from human matrix metalloproteinase 2
1HOV Solution structure of a catalytic domain of mmp-2 complexed with sc-74020

Browse structure collections

About this viewer

MolViewer shows 1J7M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.