1J8C: Ubiquitin-like Domain of hPLIC-2

Solution Structure of the Ubiquitin-like Domain of hPLIC-2. Determined by solution NMR. Released 20 Mar 2002.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 780
Mol. weight: 13.64 kDa
Released: 20 Mar 2002

Explore 1J8C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1J8C contains 2 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	33-38	6	1
β-strand	43-48	6	1
α-helix	54-65	12
β-strand	72-76	5	1
β-strand	79-81	3	1
α-helix	87-89	3
β-strand	96-102	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ubiquitin-like protein hPLIC-2	A	protein	125	Homo sapiens	Q9UHD9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1J8C_1 ubiquitin-like protein hPLIC-2 (chains A)
MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEA
ISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKRDPNSSSVDKYAAALEH
HHHHH

Primary citation

Structural studies of the interaction between ubiquitin family proteins and proteasome subunit S5a. Walters, K.J., Kleijnen, M.F., Goh, A.M. et al. Biochemistry (2002) 41:1767-1777. DOI 10.1021/bi011892y · PubMed

Other PDB entries of the same protein (UniProt Q9UHD9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2NBV Solution structure of the Rpn13 Pru domain engaging the hPLIC2 UBL domain
6MUN Structure of hRpn10 bound to UBQLN2 UBL
7F7X Protein complex between phosphorylated ubiquitin and Ubqln2 UBA

Browse structure collections

About this viewer

MolViewer shows 1J8C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.