1J8I: Human Lymphotactin

Solution Structure of Human Lymphotactin. Determined by solution NMR. Released 24 Oct 2001.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 716
Mol. weight: 10.29 kDa
Released: 24 Oct 2001

Explore 1J8I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1J8I contains 2 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	21-23	3
β-strand	24-29	6	1
β-strand	37-41	5	1
β-strand	46-49	4	1
α-helix	54-66	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lymphotactin	A	protein	93	Homo sapiens	P47992 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1J8I_1 Lymphotactin (chains A)
VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVV
RSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Primary citation

Monomeric solution structure of the prototypical 'C' chemokine lymphotactin. Kuloglu, E.S., McCaslin, D.R., Kitabwalla, M. et al. Biochemistry (2001) 40:12486-12496. DOI 10.1021/bi011106p · PubMed

Other PDB entries of the same protein (UniProt P47992 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2NYZ 2.6 Å, Viral Chemokine Binding Protein M3 From Murine Gammaherpesvirus68 In Complex With The C-…
9AST 3.07 Å, Cryo-EM structure of XCR1 signaling complex
1J9O Solution structure of human lymphotactin
2HDM Solution structure of V21C/V59C Lymphotactin/XCL1
2JP1 Solution structure of the alternative conformation of XCL1/Lymphotactin
2N54 Solution structure of a disulfide stabilized XCL1 dimer

Browse structure collections

About this viewer

MolViewer shows 1J8I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.