2JP1: Alternative conformation of XCL1/Lymphotactin

Solution structure of the alternative conformation of XCL1/Lymphotactin. Determined by solution NMR. Released 11 Mar 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 930
Mol. weight: 20.57 kDa
Released: 11 Mar 2008

Explore 2JP1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JP1 contains 0 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	11-15	5	1
β-strand	25-31	7	1
β-strand	34-40	7	1
β-strand	44-51	8	1

Chain B: 0 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	10-15	6	2
β-strand	25-31	7	2
β-strand	34-41	8	2
β-strand	44-51	8	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lymphotactin	A, B	protein	93	Homo sapiens	P47992 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2JP1_1 Lymphotactin (chains A, B)
VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVV
RSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Primary citation

Interconversion between two unrelated protein folds in the lymphotactin native state. Tuinstra, R.L., Peterson, F.C., Kutlesa, S. et al. Proc Natl Acad Sci U S A (2008) 105:5057-5062. DOI 10.1073/pnas.0709518105 · PubMed

Other PDB entries of the same protein (UniProt P47992 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2NYZ 2.6 Å, Viral Chemokine Binding Protein M3 From Murine Gammaherpesvirus68 In Complex With The C-…
9AST 3.07 Å, Cryo-EM structure of XCR1 signaling complex
1J8I Solution Structure of Human Lymphotactin
1J9O Solution structure of human lymphotactin
2HDM Solution structure of V21C/V59C Lymphotactin/XCL1
2N54 Solution structure of a disulfide stabilized XCL1 dimer

Browse structure collections

About this viewer

MolViewer shows 2JP1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.