2NYZ: Hypothetical protein GAMMAHV.M3

Viral Chemokine Binding Protein M3 From Murine Gammaherpesvirus68 In Complex With The C- Chemokine XCL1. Determined by X-ray diffraction at 2.6 Å resolution. Released 25 Dec 2007.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Murid herpesvirus 4
Chains: 4
Atoms: 6,912
Mol. weight: 104.23 kDa
Released: 25 Dec 2007

Explore 2NYZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2NYZ contains 32 α-helices and 59 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	15-18	4	1
α-helix	23-25	3
α-helix	29-35	7
α-helix	44-57	14
α-helix	61-65	5
β-strand	68-75	8	1
β-strand	77-79	3	2
α-helix	80-82	3
β-strand	84-89	6	2
β-strand	104-112	9	1
β-strand	126-131	6	2
β-strand	136-139	4	2
α-helix	141-143	3
β-strand	144-148	5	1
β-strand	151-159	9	1
α-helix	160-162	3
β-strand	168-173	6	2
β-strand	181-187	7	1
β-strand	193-201	9	1
α-helix	206-207	2
β-strand	208	1	1
β-strand	212-216	5	3
α-helix	221-225	5
β-strand	244-246	3	4
β-strand	256-260	5	4
α-helix	263-268	6
β-strand	273-274	2	5
β-strand	279-285	7	4
β-strand	294-301	8	3
β-strand	315-325	11	3
β-strand	328-331	4	3
β-strand	339-343	5	4
β-strand	349-354	6	4
α-helix	356-358	3
β-strand	362-369	8	3
β-strand	372-377	6	3

Chain B: 16 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	15-18	4	6
α-helix	23-25	3
α-helix	29-36	8
α-helix	45-57	13
α-helix	61-65	5
β-strand	68-75	8	6
β-strand	77-79	3	7
α-helix	80-82	3
β-strand	84-90	7	7
β-strand	104-112	9	6
α-helix	119-120	2
α-helix	123-124	2
β-strand	127-131	5	7
β-strand	136-138	3	7
α-helix	141-143	3
β-strand	144-148	5	6
β-strand	151-159	9	6
α-helix	160-162	3
β-strand	168-173	6	7
β-strand	181-189	9	6
β-strand	192-201	10	6
β-strand	208	1	6
β-strand	212-216	5	8
α-helix	221-224	4
α-helix	227-229	3
α-helix	230-233	4
β-strand	244-246	3	9
β-strand	257-260	4	9
α-helix	263-268	6
β-strand	273-274	2	10
β-strand	279-285	7	9
α-helix	287-289	3
β-strand	294-301	8	8
α-helix	313-314	2
β-strand	315-325	11	8
β-strand	328-331	4	8
β-strand	339-343	5	9
β-strand	349-354	6	9
α-helix	356-361	6
β-strand	362-369	8	8
β-strand	372-377	6	8

Chain D: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	9-10	2	5
α-helix	21-23	3
β-strand	26	1	11
β-strand	29-30	2	11
β-strand	36-41	6	11
β-strand	44-49	6	11
α-helix	54-61	8
α-helix	64-66	3

Chain E: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	9-10	2	10
α-helix	21-23	3
β-strand	24-28	5	12
β-strand	37-41	5	12
β-strand	46-49	4	12
α-helix	54-64	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hypothetical protein GAMMAHV.M3	A, B	protein	382	Murid herpesvirus 4	O41925 (AlphaFold model)
Lymphotactin	D, E	protein	93		P47992 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2NYZ_1 Hypothetical protein GAMMAHV.M3 (chains A, B)
LTLGLAPALSTHSSGVSTQSVDLSQIKRGDEIQAHCLTPAETEVTECAGILKDVLSKNLH
ELQGLCNVKNKMGVPWVSVEELGQEIITGRLPFPSVGGTPVNDLVRVLVVAESNTPEETP
EEEFYAYVELQTELYTFGLSDDNVVFTSDYMTVWMIDIPKSYVDVGMLTRATFLEQWPGA
KVTVMIPYSSTFTWCGELGAISEESAPQPSLSARSPVCKNSARYSTSKFCEVDGCTAETG
MEKMSLLTPFGGPPQQAKMNTCPCYYKYSVSPLPAMDHLILADLAGLDSLTSPVYVMAAY
FDSTHENPVRPSSKLYHCALQMTSHDGVWTSTSSEQCPIRLVEGQSQNVLQVRVAPTSMP
NLVGVSLMLEGQQYRLEYFGDH

Sequence of entity 2 (D, E), FASTA

>2NYZ_2 Lymphotactin (chains D, E)
VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVV
RSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Primary citation

Dual GPCR and GAG mimicry by the M3 chemokine decoy receptor. Alexander-Brett, J.M., Fremont, D.H. J Exp Med (2007) 204:3157-3172. DOI 10.1084/jem.20071677 · PubMed

Other PDB entries of the same protein (UniProt O41925 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MKF 2.1 Å, Viral chemokine binding protein M3 from murine gammaherpesvirus 68
2NZ1 2.5 Å, Viral Chemokine Binding Protein M3 From Murine Gammaherpesvirus68 In Complex With The…
1ML0 2.8 Å, Viral chemokine binding protein M3 from murine GAMMAHERPESVIRUS68 in complex with the…

Browse structure collections

About this viewer

MolViewer shows 2NYZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.