1JCH: Colicin E3

Crystal Structure of Colicin E3 in Complex with its Immunity Protein. Determined by X-ray diffraction at 3.02 Å resolution. Released 30 Nov 2001.

Method: X-ray diffraction
Resolution: 3.02 Å
Organism: Escherichia coli str. K12 substr.
Chains: 4
Atoms: 8,998
Mol. weight: 136.78 kDa
Ligands: CIT
Released: 30 Nov 2001

Explore 1JCH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JCH contains 32 α-helices and 84 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 11 helices, 36 β-strands

Element	Residues	Length	Sheet
β-strand	92	1	1
β-strand	98	1	2
β-strand	105	1	3
β-strand	108	1	1
β-strand	109	1	4
α-helix	116-119	4
α-helix	120-124	5
β-strand	132-134	3	5
β-strand	135	1	6
β-strand	150	1	2
β-strand	154-155	2	7
β-strand	171-173	3	8
β-strand	177	1	9
β-strand	182-183	2	10
β-strand	188-189	2	10
β-strand	192	1	6
β-strand	194	1	9
β-strand	201-203	3	8
β-strand	204	1	7
α-helix	205-207	3
β-strand	227	1	3
β-strand	231	1	4
β-strand	253-255	3	5
β-strand	269-270	2	7
β-strand	283-285	3	7
β-strand	288	1	2
α-helix	293-313	21
α-helix	315-373	59
α-helix	376-378	3
α-helix	386-440	55
α-helix	444-447	4
α-helix	457-462	6
α-helix	465-469	5
α-helix	470-472	3
β-strand	481-482	2	11
β-strand	487	1	12
β-strand	494	1	12
β-strand	497-498	2	11
β-strand	505-508	4	11
β-strand	510	1	13
β-strand	515	1	13
β-strand	518-520	3	11
β-strand	525	1	14
β-strand	526-528	3	11
β-strand	529-530	2	15
β-strand	537-539	3	15
β-strand	546	1	14

Chains B and D: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	2-10	9	16
β-strand	16-21	6	16
α-helix	30-35	6
β-strand	43	1	16
β-strand	47	1	12
β-strand	48-49	2	16
α-helix	50	1
α-helix	52-54	3
α-helix	55-58	4
α-helix	59-61	3
β-strand	71-79	9	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Colicin E3	A, C	protein	551	Escherichia coli str. K12 substr.	P00646 (AlphaFold model)
Colicin E3 immunity protein	B, D	protein	84	Escherichia coli str. K12 substr.	P02984 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1JCH_1 COLICIN E3 (chains A, C)
MSGGDGRGHNTGAHSTSGNINGGPTGLGVGGGASDGSGWSSENNPWGGGSGSGIHWGGGS
GHGNGGGNGNSGGGSGTGGNLSAVAAPVAFGFPALSTPGAGGLAVSISAGALSAAIADIM
AALKGPFKFGLWGVALYGVLPSQIAKDDPNMMSKIVTSLPADDITESPVSSLPLDKATVN
VNVRVVDDVKDERQNISVVSGVPMSVPVVDAKPTERPGVFTASIPGAPVLNISVNNSTPA
VQTLSPGVTNNTDKDVRPAFGTQGGNTRDAVIRFPKDSGHNAVYVSVSDVLSPDQVKQRQ
DEENRRQQEWDATHPVEAAERNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDA
ANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSD
ADAALSSAMESRKKKEDKKRSAENNLNDEKNKPRKGFKDYGHDYHPAPKTENIKGLGDLK
PGIPKTPKQNGGGKRKRWTGDKGRKIYEWDSQHGELEGYRASDGQHLGSFDPKTGNQLKG
PDPKRNIKKYL

Sequence of entity 2 (B, D), FASTA

>1JCH_2 COLICIN E3 IMMUNITY PROTEIN (chains B, D)
GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQP
YFNHQIDISDNEYFVSFDYRDGDW

Ligands and cofactors

ID	Name	Formula	Copies
CIT	Citric acid	C6 H8 O7	4

Water and common crystallization additives (GOL) are not listed.

Primary citation

Crystal structure of colicin E3: implications for cell entry and ribosome inactivation. Soelaiman, S., Jakes, K., Wu, N. et al. Mol Cell (2001) 8:1053-1062. DOI 10.1016/S1097-2765(01)00396-3 · PubMed

Other PDB entries of the same protein (UniProt P00646 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2B5U 2.3 Å, Crystal Structure Of Colicin E3 V206C Mutant In Complex With Its Immunity Protein
1E44 2.4 Å, ribonuclease domain of colicin E3 in complex with its immunity protein
1UJW 2.75 Å, Structure of the complex between BtuB and Colicin E3 Receptor binding domain
4UDM 2.96 Å, Crystal structure of Im3 in complex with Y52A mutant of E3RNase
4V5K 3.2 Å, Structure of cytotoxic domain of colicin E3 bound to the 70S ribosome

Browse structure collections

About this viewer

MolViewer shows 1JCH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.