1JI7: TEL SAM Polymer

Name: PDB 1JI7: Crystal Structure of TEL SAM Polymer
Published: 2002-07-03
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal Structure of TEL SAM Polymer. Determined by X-ray diffraction at 1.45 Å resolution. Released 3 Jul 2002.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,347
Mol. weight: 33.33 kDa
Released: 3 Jul 2002

Explore 1JI7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JI7 contains 22 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	20-22	3
α-helix	26-28	3
α-helix	31-44	14
α-helix	47	1
α-helix	49	1
α-helix	59-62	4
α-helix	67-73	7
α-helix	78-90	13

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	20-22	3
α-helix	26-28	3
α-helix	31-45	15
α-helix	47-49	3
α-helix	52-55	4
α-helix	59-62	4
α-helix	67-73	7
α-helix	78-90	13

Chain C: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	20-22	3
α-helix	26-28	3
α-helix	31-44	14
α-helix	59-62	4
α-helix	67-73	7
α-helix	78-97	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ets-related protein TEL1	A, B, C	protein	89	Homo sapiens	P41212 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1JI7_1 ETS-RELATED PROTEIN TEL1 (chains A, B, C)
SIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRS
PHSGDELYELLQHILKQRDHHHHHHHRHD

Primary citation

Polymerization of the SAM domain of TEL in leukemogenesis and transcriptional repression. Kim, C.A., Phillips, M.L., Kim, W. et al. EMBO J (2001) 20:4173-4182. DOI 10.1093/emboj/20.15.4173 · PubMed

Other PDB entries of the same protein (UniProt P41212 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DOC 1.19 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
9ZB7 1.24 Å, A DARPin fused to the 1TEL crystallization chaperone via a direct helical fusion
9Q4D 1.3 Å, A DARPin fused to the double trigger 1TEL variant crystallization chaperone via a direct…
7TW9 1.41 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to Sinefungin
7TDY 1.53 Å, The ubiquitin-associated domain of human thirty-eight negative kinase 1, flexibly fused…
7TW8 1.55 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAH
8FRJ 1.57 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC0946
9DB5 1.57 Å, A DARPin fused to the 1TEL crystallization chaperone via a proline-alanine linker
8FT8 1.6 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
8FRK 1.61 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC8158
7TW7 1.62 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAM
8THA 1.68 Å, 1TEL, non-compressed, double-helical crystal form

Browse structure collections

About this viewer

MolViewer shows 1JI7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.