Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC0946. Determined by X-ray diffraction at 1.57 Å resolution. Released 26 Jul 2023.
Explore 8FRJ in 3D Show helices and sheets RCSB PDB PDBe
8FRJ contains 16 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-10 | 4 | |
| α-helix | 13-15 | 3 | |
| α-helix | 18-32 | 15 | |
| α-helix | 34-36 | 3 | |
| α-helix | 46-49 | 4 | |
| α-helix | 54-60 | 7 | |
| α-helix | 65-77 | 13 | |
| α-helix | 79-301 | 5 | |
| α-helix | 302-324 | 23 | |
| β-strand | 328-332 | 5 | 1 |
| β-strand | 347-352 | 6 | 1 |
| α-helix | 360-362 | 3 | |
| β-strand | 364-365 | 2 | 1 |
| α-helix | 370-373 | 4 | |
| β-strand | 381-385 | 5 | 1 |
| β-strand | 396-401 | 6 | 1 |
| α-helix | 434-436 | 3 | |
| β-strand | 439-441 | 3 | 1 |
| β-strand | 446-447 | 2 | 2 |
| α-helix | 451-452 | 2 | |
| β-strand | 473-474 | 2 | 2 |
| α-helix | 476-478 | 3 | |
| α-helix | 485-503 | 19 | |
| β-strand | 506-511 | 6 | 1 |
| α-helix | 516-520 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transcription factor ETV6,Guanine-N7 methyltransferase nsp14 chimera | A | protein | 309 | Severe acute respiratory syndrome coronavirus 2 | P0DTD1 (AlphaFold model), P41212 (AlphaFold model) |
>8FRJ_1 Transcription factor ETV6,Guanine-N7 methyltransferase nsp14 chimera (chains A) GSIALPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYR SPHSGDELYELLQHILAQPAAGDELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAI KCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIV CRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQ VVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYN LWNTFTRLQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| AW2 | 5-bromo-7-{5-[(3-{[(4-tert-butylphenyl)carbamoyl]amino}propyl)(propan-2-yl)amin… | C28 H40 Br N7 O4 | 1 |
| ZN | Zinc ion | Zn | 1 |
Structures of SARS-CoV-2 N7-methyltransferase with DOT1L and PRMT7 inhibitors provide a platform for new antivirals. Kottur, J., White, K.M., Rodriguez, M.L. et al. PLoS Pathog (2023) 19:e1011546-e1011546. DOI 10.1371/journal.ppat.1011546 · PubMed
Other PDB entries of the same protein (UniProt P0DTD1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8FRJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.