Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to Sinefungin. Determined by X-ray diffraction at 1.41 Å resolution. Released 7 Sept 2022.
Explore 7TW9 in 3D Show helices and sheets RCSB PDB PDBe
7TW9 contains 17 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-10 | 4 | |
| α-helix | 13-15 | 3 | |
| α-helix | 18-32 | 15 | |
| α-helix | 34-36 | 3 | |
| α-helix | 39-42 | 4 | |
| α-helix | 46-49 | 4 | |
| α-helix | 54-60 | 7 | |
| α-helix | 65-77 | 13 | |
| α-helix | 79-301 | 5 | |
| α-helix | 302-324 | 23 | |
| β-strand | 328-332 | 5 | 1 |
| β-strand | 347-352 | 6 | 1 |
| α-helix | 360-362 | 3 | |
| β-strand | 364-365 | 2 | 1 |
| α-helix | 370-373 | 4 | |
| β-strand | 381-385 | 5 | 1 |
| β-strand | 396-401 | 6 | 1 |
| α-helix | 434-436 | 3 | |
| β-strand | 439-441 | 3 | 1 |
| β-strand | 446-447 | 2 | 2 |
| α-helix | 451-452 | 2 | |
| β-strand | 473-474 | 2 | 2 |
| α-helix | 476-478 | 3 | |
| α-helix | 485-503 | 19 | |
| β-strand | 506-511 | 6 | 1 |
| α-helix | 517-520 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transcription factor ETV6,Proofreading exoribonuclease nsp14 chimera | A | protein | 309 | Severe acute respiratory syndrome coronavirus 2 | P0DTD1 (AlphaFold model), P41212 (AlphaFold model) |
>7TW9_1 Transcription factor ETV6,Proofreading exoribonuclease nsp14 chimera (chains A) GSIALPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYR SPHSGDELYELLQHILAQPAAGDELKINAACRKVQHMVVKAALLADKFPVLHDIGNPKAI KCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCLFWNCNVDRYPANSIV CRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQLPFFYYSDSPCESHGKQ VVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYNMMISAGFSLWVYKQFDTYN LWNTFTRLQ
Water and common crystallization additives (PEG) are not listed.
High-resolution structures of the SARS-CoV-2 N7-methyltransferase inform therapeutic development. Kottur, J., Rechkoblit, O., Quintana-Feliciano, R. et al. Nat Struct Mol Biol (2022) 29:850-853. DOI 10.1038/s41594-022-00828-1 · PubMed
Other PDB entries of the same protein (UniProt P0DTD1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7TW9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.