1JKG: P15

Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain of TAP-p15 mRNA nuclear export factor. Determined by X-ray diffraction at 1.9 Å resolution. Released 17 Oct 2001.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,752
Mol. weight: 43.85 kDa
Released: 17 Oct 2001

Explore 1JKG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JKG contains 16 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	6-30	25
α-helix	32-38	7
β-strand	39-47	9	1
β-strand	50-53	4	1
α-helix	55-64	10
α-helix	66-67	2
β-strand	68-79	12	1
α-helix	80-81	2
β-strand	90-101	12	1
β-strand	107-118	12	1
β-strand	125-135	11	1

Chain B: 11 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	371-373	3
β-strand	377	1	2
α-helix	381-398	18
α-helix	403-408	6
β-strand	410-419	10	2
α-helix	433-436	4
β-strand	439	1	2
α-helix	448-454	7
β-strand	456-457	2	2
α-helix	459-466	8
α-helix	470-471	2
β-strand	472-474	3	2
α-helix	476-478	3
β-strand	480-486	7	2
β-strand	491-501	11	2
β-strand	510-521	12	2
β-strand	527-538	12	2
α-helix	539-540	2
α-helix	541-548	8
α-helix	551-553	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
p15	A	protein	140	Homo sapiens	Q9UKK6 (AlphaFold model)
TAP	B	protein	250	Homo sapiens	Q9UBU9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1JKG_1 p15 (chains A)
MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE
FFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQAS
PSNTVWKIASDCFRFQDWAS

Sequence of entity 2 (B), FASTA

>1JKG_2 TAP (chains B)
APPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFIPQNPAR
SSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTST
LLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFA
MPAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAK
GEIPEVAFMK

Primary citation

Structural basis for the recognition of a nucleoporin FG repeat by the NTF2-like domain of the TAP/p15 mRNA nuclear export factor. Fribourg, S., Braun, I.C., Izaurralde, E. et al. Mol Cell (2001) 8:645-656. DOI 10.1016/S1097-2765(01)00348-3 · PubMed

Other PDB entries of the same protein (UniProt Q9UKK6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9I8A 1.5 Å, NXT1-NXF1 complex crystallized in space group P65 2 2
1JN5 2.8 Å, Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain…
4WYK 3.4 Å, Structure of the LRR and NTF2-like domains of NXF1 complexed with NXT1
6E5U 3.8 Å, Crystal structure of the mRNA export receptor NXF1/NXT1 in complex with influenza virus…

Browse structure collections

About this viewer

MolViewer shows 1JKG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.