1JL9: Human Epidermal Growth Factor

Crystal Structure of Human Epidermal Growth Factor. Determined by X-ray diffraction at 3.0 Å resolution. Released 24 Oct 2001.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 704
Mol. weight: 11.92 kDa
Released: 24 Oct 2001

Explore 1JL9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JL9 contains 4 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	18	1
β-strand	19-23	5	1
α-helix	24-26	3
β-strand	28-32	5	1
α-helix	33-34	2
β-strand	37-38	2	2
β-strand	44-45	2	2

Chain B: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	19-23	5	3
α-helix	24-26	3
β-strand	28-32	5	3
β-strand	37-38	2	4
β-strand	44-45	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Epidermal growth factor	A, B	protein	51	Homo sapiens	P01133 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1JL9_1 EPIDERMAL GROWTH FACTOR (chains A, B)
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWE

Primary citation

Crystal structure of human epidermal growth factor and its dimerization. Lu, H.S., Chai, J.J., Li, M. et al. J Biol Chem (2001) 276:34913-34917. DOI 10.1074/jbc.M102874200 · PubMed

Other PDB entries of the same protein (UniProt P01133 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1NQL 2.8 Å, Structure of the extracellular domain of human epidermal growth factor (EGF) receptor in…
7SYD 3.1 Å, Cryo-EM structure of the extracellular module of the full-length EGFR bound to EGF…
1IVO 3.3 Å, Crystal Structure of the Complex of Human Epidermal Growth Factor and Receptor…
7SYE 3.3 Å, Cryo-EM structure of the extracellular module of the full-length EGFR bound to EGF.…
7SZ0 3.3 Å, Cryo-EM structure of the extracellular module of the full-length EGFR L834R bound to…
3NJP 3.3 Å, The Extracellular and Transmembrane Domain Interfaces in Epidermal Growth Factor…
8HGO 3.31 Å, The EGF-bound EGFR/HER2 ectodomain complex
7SZ1 3.4 Å, Cryo-EM structure of the extracellular module of the full-length EGFR L834R bound to…
8HGS 3.81 Å, The EGF-bound EGFR ectodomain homodimer
7OM4 6.05 Å, Nanobody EgB4 bound to the full extracellular EGFR-EGF complex
1P9J Solution structure and dynamics of the EGF/TGF-alpha chimera T1E
2KV4 EGF

Browse structure collections

About this viewer

MolViewer shows 1JL9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.