1IVO: Epidermal Growth Factor Receptor

Crystal Structure of the Complex of Human Epidermal Growth Factor and Receptor Extracellular Domains. Determined by X-ray diffraction at 3.3 Å resolution. Released 16 Oct 2002.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 4
Atoms: 8,892
Mol. weight: 152.21 kDa
Ligands: NAG
Released: 16 Oct 2002

Explore 1IVO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IVO contains 32 α-helices and 101 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 40 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	1
β-strand	16-17	2	2
α-helix	20-31	12
β-strand	36-37	2	1
β-strand	41-43	3	3
α-helix	53-57	5
β-strand	60-61	2	1
β-strand	65-68	4	3
β-strand	74	1	4
α-helix	77-79	3
β-strand	82-83	2	1
β-strand	89	1	3
β-strand	93-98	6	3
β-strand	110	1	4
β-strand	118	1	1
β-strand	123-127	5	3
α-helix	135-137	3
β-strand	154	1	3
β-strand	212-213	2	5
β-strand	226-227	2	5
β-strand	230-232	3	6
β-strand	235-237	3	6
β-strand	244-247	4	7
β-strand	252-255	4	7
β-strand	261-263	3	6
β-strand	266-268	3	6
β-strand	276-277	2	8
β-strand	282	1	6
β-strand	283-284	2	8
β-strand	291	1	9
β-strand	304	1	9
β-strand	313	1	10
α-helix	319-321	3
α-helix	329-331	3
α-helix	333-335	3
β-strand	340-341	2	10
β-strand	345-347	3	11
α-helix	349-353	5
α-helix	361-363	3
α-helix	365-373	9
β-strand	376-377	2	10
β-strand	381-383	3	11
α-helix	394-396	3
β-strand	401-402	2	10
β-strand	408	1	11
β-strand	412-417	6	11
β-strand	431	1	10
β-strand	436-440	5	11
α-helix	448-450	3
α-helix	453-456	4
β-strand	464-465	2	11
α-helix	472-474	3
β-strand	491	1	12
β-strand	499	1	12

Chain B: 14 helices, 53 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	13
β-strand	16-17	2	14
α-helix	22-31	10
β-strand	36-37	2	13
β-strand	41-44	4	15
α-helix	53-57	5
β-strand	60-61	2	13
β-strand	65-68	4	15
β-strand	74	1	16
β-strand	82-83	2	13
β-strand	95-98	4	15
β-strand	110	1	16
β-strand	118-119	2	13
β-strand	124-127	4	15
α-helix	135-137	3
β-strand	144	1	13
α-helix	146-149	4
β-strand	154	1	15
β-strand	175	1	17
β-strand	183	1	17
β-strand	199	1	18
β-strand	207	1	18
β-strand	212-216	5	19
β-strand	224-227	4	19
β-strand	230-232	3	20
β-strand	235-237	3	20
β-strand	244-247	4	21
β-strand	252-255	4	21
β-strand	261-263	3	20
β-strand	266-268	3	20
β-strand	276-277	2	22
α-helix	278	1
β-strand	282	1	20
β-strand	283-284	2	22
β-strand	291	1	23
β-strand	300	1	22
β-strand	304	1	23
β-strand	313	1	24
β-strand	316	1	25
α-helix	319-321	3
α-helix	333-335	3
β-strand	340-341	2	24
β-strand	344	1	25
β-strand	345-347	3	26
α-helix	349-353	5
β-strand	355	1	27
β-strand	360	1	27
α-helix	361-363	3
α-helix	365-373	9
β-strand	376-377	2	24
β-strand	381-383	3	26
β-strand	392	1	28
β-strand	401-402	2	24
β-strand	408	1	26
β-strand	412-417	6	26
β-strand	423	1	28
β-strand	431-432	2	24
β-strand	436-440	5	26
α-helix	448-450	3
α-helix	453-455	3
β-strand	464-465	2	26
α-helix	472-475	4
β-strand	483	1	29
β-strand	486	1	29
β-strand	491	1	30
α-helix	496-498	3
β-strand	499	1	30

Chain C: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	19-23	5	2
α-helix	24-26	3
β-strand	28-33	6	2
α-helix	34	1
β-strand	37-38	2	31
β-strand	44-45	2	31

Chain D: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	18	1
β-strand	19-22	4	14
β-strand	29-33	5	14
α-helix	34	1
β-strand	37-38	2	32
β-strand	44-45	2	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Epidermal Growth Factor Receptor	A, B	protein	622	Homo sapiens	P00533 (AlphaFold model)
Epidermal growth factor	C, D	protein	53	Homo sapiens	P01133 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1IVO_1 Epidermal Growth Factor Receptor (chains A, B)
LEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQE
VAGYVLIALNTVERIPLENLQIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNLQEIL
HGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHLGSCQKCDPSCPNGSCWGAGE
ENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTC
PPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVR
KCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHT
PPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLN
ITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQ
VCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLP
QAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNC
TYGCTGPGLEGCPTNGPKIPSI

Sequence of entity 2 (C, D), FASTA

>1IVO_2 Epidermal growth factor (chains C, D)
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	8

Primary citation

Crystal Structure of the Complex of Human Epidermal Growth Factor and Receptor Extracellular Domains. Ogiso, H., Ishitani, R., Nureki, O. et al. Cell (2002) 110:775-787. DOI 10.1016/S0092-8674(02)00963-7 · PubMed

Other PDB entries of the same protein (UniProt P00533 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8A27 1.07 Å, EGFR kinase domain in complex with 2-(6,7-dihydro-5H-pyrrolo[1,2-c]imidazol-1-yl)-2-[6-[2…
8A2D 1.11 Å, EGFR kinase domain (L858R/V948R) in complex with 2-[4-(difluoromethyl)-6-[2-[4-[[4-(hydro…
5UG9 1.33 Å, Crystal structure of the EGFR kinase domain (L858R, T790M, V948R) in complex with a…
5HG8 1.42 Å, EGFR (L858R, T790M, V948R) in complex with N-[3-({2-[(1-methyl-1H-pyrazol-4-yl)amino]-7H-…
8A2A 1.43 Å, EGFR kinase domain in complex with 2-(6,7-dihydro-5H-pyrrolo[1,2-c]imidazol-1-yl)-2-[6-[2…
5UG8 1.46 Å, Crystal structure of the EGFR kinase domain (L858R, T790M, V948R) in complex with a…
3POZ 1.5 Å, EGFR Kinase domain complexed with tak-285
6TFV 1.5 Å, Crystal Structure of EGFR T790M/V948R in Complex with Covalent Pyrrolopyrimidine 18b
6TG0 1.5 Å, Crystal Structure of EGFR T790M/V948R in Complex with Covalent Pyrrolopyrimidine 21a
3VRP 1.52 Å, Crystal structure of the tyrosine kinase binding domain of Cbl-c in complex with…
5HG5 1.52 Å, EGFR (L858R, T790M, V948R) in complex with N-{3-[(2-{[4-(4-methylpiperazin-1-yl)phenyl]am…
5CNO 1.55 Å, Crystal structure of the EGFR kinase domain mutant V924R

Browse structure collections

About this viewer

MolViewer shows 1IVO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.