Crystal Structure of a Human Tcf-4 / beta-Catenin Complex. Determined by X-ray diffraction at 2.5 Å resolution. Released 5 Dec 2001.
Explore 1JPW in 3D Show helices and sheets RCSB PDB PDBe
1JPW contains 120 α-helices and 4 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 152-160 | 9 | |
| α-helix | 165-178 | 14 | |
| α-helix | 182-189 | 8 | |
| α-helix | 192-204 | 13 | |
| α-helix | 210-221 | 12 | |
| α-helix | 225-233 | 9 | |
| α-helix | 236-243 | 8 | |
| α-helix | 249-265 | 17 | |
| α-helix | 269-275 | 7 | |
| α-helix | 278-284 | 7 | |
| α-helix | 285-287 | 3 | |
| α-helix | 291-305 | 15 | |
| α-helix | 309-317 | 9 | |
| α-helix | 320-330 | 11 | |
| α-helix | 334-347 | 14 | |
| α-helix | 353-359 | 7 | |
| α-helix | 362-366 | 5 | |
| α-helix | 367-369 | 3 | |
| α-helix | 375-389 | 15 | |
| α-helix | 399-409 | 11 | |
| α-helix | 414-427 | 14 | |
| α-helix | 432-440 | 9 | |
| α-helix | 443-454 | 12 | |
| α-helix | 458-471 | 14 | |
| α-helix | 478-487 | 10 | |
| α-helix | 491-496 | 6 | |
| α-helix | 504-517 | 14 | |
| α-helix | 521-523 | 3 | |
| α-helix | 524-529 | 6 | |
| α-helix | 532-546 | 15 | |
| β-strand | 561 | 1 | 1 |
| β-strand | 564 | 1 | 1 |
| α-helix | 566-580 | 15 | |
| α-helix | 584-592 | 9 | |
| α-helix | 596-601 | 6 | |
| α-helix | 602-604 | 3 | |
| α-helix | 608-622 | 15 | |
| α-helix | 625-632 | 8 | |
| α-helix | 637-643 | 7 | |
| α-helix | 649-661 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 153-160 | 8 | |
| α-helix | 165-178 | 14 | |
| α-helix | 182-189 | 8 | |
| α-helix | 192-204 | 13 | |
| α-helix | 208-222 | 15 | |
| α-helix | 225-233 | 9 | |
| α-helix | 236-242 | 7 | |
| α-helix | 243-245 | 3 | |
| α-helix | 249-264 | 16 | |
| α-helix | 269-275 | 7 | |
| α-helix | 278-284 | 7 | |
| α-helix | 291-305 | 15 | |
| α-helix | 309-317 | 9 | |
| α-helix | 320-330 | 11 | |
| α-helix | 334-347 | 14 | |
| α-helix | 353-359 | 7 | |
| α-helix | 362-366 | 5 | |
| α-helix | 375-389 | 15 | |
| α-helix | 399-407 | 9 | |
| α-helix | 408-410 | 3 | |
| α-helix | 414-426 | 13 | |
| α-helix | 432-440 | 9 | |
| α-helix | 443-454 | 12 | |
| α-helix | 458-471 | 14 | |
| α-helix | 478-487 | 10 | |
| α-helix | 491-496 | 6 | |
| α-helix | 504-517 | 14 | |
| α-helix | 521-523 | 3 | |
| α-helix | 524-529 | 6 | |
| α-helix | 532-546 | 15 | |
| β-strand | 561 | 1 | 2 |
| β-strand | 564 | 1 | 2 |
| α-helix | 566-580 | 15 | |
| α-helix | 584-591 | 8 | |
| α-helix | 596-602 | 7 | |
| α-helix | 608-621 | 14 | |
| α-helix | 625-632 | 8 | |
| α-helix | 637-643 | 7 | |
| α-helix | 649-660 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 153-160 | 8 | |
| α-helix | 165-178 | 14 | |
| α-helix | 182-189 | 8 | |
| α-helix | 192-204 | 13 | |
| α-helix | 208-222 | 15 | |
| α-helix | 225-232 | 8 | |
| α-helix | 236-242 | 7 | |
| α-helix | 243-245 | 3 | |
| α-helix | 249-264 | 16 | |
| α-helix | 269-275 | 7 | |
| α-helix | 278-284 | 7 | |
| α-helix | 285-287 | 3 | |
| α-helix | 291-305 | 15 | |
| α-helix | 309-317 | 9 | |
| α-helix | 320-330 | 11 | |
| α-helix | 334-347 | 14 | |
| α-helix | 353-359 | 7 | |
| α-helix | 362-366 | 5 | |
| α-helix | 375-389 | 15 | |
| α-helix | 399-407 | 9 | |
| α-helix | 408-410 | 3 | |
| α-helix | 414-427 | 14 | |
| α-helix | 432-440 | 9 | |
| α-helix | 443-454 | 12 | |
| α-helix | 458-471 | 14 | |
| α-helix | 478-487 | 10 | |
| α-helix | 491-496 | 6 | |
| α-helix | 504-517 | 14 | |
| α-helix | 521-523 | 3 | |
| α-helix | 524-529 | 6 | |
| α-helix | 532-548 | 17 | |
| α-helix | 561-563 | 3 | |
| α-helix | 566-580 | 15 | |
| α-helix | 584-591 | 8 | |
| α-helix | 596-602 | 7 | |
| α-helix | 608-621 | 14 | |
| α-helix | 626-632 | 7 | |
| α-helix | 637-643 | 7 | |
| α-helix | 649-660 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 17-18 | 2 | |
| α-helix | 42-49 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Beta-catenin | A, B, C | protein | 540 | Homo sapiens | P35222 (AlphaFold model) |
| transcription factor 7-like 2 | D, E, F | protein | 49 | Homo sapiens | Q9NQB0 (AlphaFold model) |
>1JPW_1 BETA-CATENIN (chains A, B, C) MGSHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMR SPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDS VLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQE SKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHL TDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCN NYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYG LPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRR TSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENI QRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDY
>1JPW_2 transcription factor 7-like 2 (chains D, E, F) GSGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESET
Structure of a human Tcf4-beta-catenin complex. Poy, F., Lepourcelet, M., Shivdasani, R.A. et al. Nat Struct Biol (2001) 8:1053-1057. DOI 10.1038/nsb720 · PubMed
Other PDB entries of the same protein (UniProt P35222 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1JPW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.