1JWL: Dimeric lac Repressor/Operator O1/ONPF Complex

Structure of the Dimeric lac Repressor/Operator O1/ONPF Complex. Determined by X-ray diffraction at 4.0 Å resolution. Released 5 Oct 2001.

Method: X-ray diffraction
Resolution: 4.0 Å
Organism: Escherichia coli
Chains: 5
Atoms: 7,272
Mol. weight: 122.24 kDa
Ligands: NPF
Released: 5 Oct 2001

Explore 1JWL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JWL contains 38 α-helices and 42 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4
α-helix	17-24	8
α-helix	33-45	13
α-helix	51-56	6
β-strand	63-69	7	1
α-helix	74-89	16
β-strand	93-99	7	1
α-helix	104-116	13
β-strand	121-125	5	1
α-helix	130-139	10
β-strand	145-147	3	1
β-strand	158-161	4	1
α-helix	163-176	14
β-strand	182-186	5	2
α-helix	192-206	15
β-strand	214-217	4	2
α-helix	222-234	13
β-strand	241-244	4	2
α-helix	247-258	12
β-strand	264	1	3
β-strand	268	1	3
β-strand	269-274	6	2
α-helix	278-281	4
α-helix	285-286	2
β-strand	287-290	4	2
α-helix	293-308	16
β-strand	316-319	4	1
β-strand	322-324	3	2

Chain B: 14 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4
α-helix	17-24	8
α-helix	33-45	13
α-helix	51-56	6
β-strand	63-68	6	4
α-helix	74-89	16
β-strand	93-98	6	4
α-helix	104-116	13
β-strand	121-125	5	4
α-helix	130-139	10
β-strand	145-147	3	4
β-strand	158-161	4	4
α-helix	163-176	14
β-strand	182-186	5	5
α-helix	192-206	15
β-strand	214-217	4	5
α-helix	222-234	13
β-strand	241-244	4	5
α-helix	247-258	12
β-strand	264	1	6
β-strand	268	1	6
β-strand	269-274	6	5
α-helix	278-281	4
α-helix	285-286	2
β-strand	287-290	4	5
α-helix	293-308	16
β-strand	316-319	4	4
β-strand	322-324	3	5

Chain C: 10 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	63-68	6	7
α-helix	74-89	16
β-strand	93-98	6	7
α-helix	104-116	13
β-strand	121-125	5	7
α-helix	130-139	10
β-strand	145-147	3	7
β-strand	158-161	4	7
α-helix	163-176	14
β-strand	182-186	5	8
α-helix	192-206	15
β-strand	214-217	4	8
α-helix	222-234	13
β-strand	241-244	4	8
α-helix	247-258	12
β-strand	264	1	9
β-strand	268	1	9
β-strand	269-274	6	8
α-helix	278-281	4
α-helix	285-286	2
β-strand	287-290	4	8
α-helix	293-308	16
β-strand	316-319	4	7
β-strand	322-324	3	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(apgpapapttpgptpgpapgpcpgpgpaptpapapcpapaptp*t)-3'	D	DNA	23
5'-d(tpapaptptpgptptpaptpcpcpgpcptpcpapcpapaptptp*c)-3'	E	DNA	23
Lactose Operon Repressor	A, B, C	protein	333	Escherichia coli	P03023 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>1JWL_1 5'-D(*AP*GP*AP*AP*T*TP*GP*TP*GP*AP*GP*CP*GP*GP*AP*TP*AP*AP*CP*AP*AP*TP*T)-3' (chains D)
AGAATTGTGAGCGGATAACAATT

Sequence of entity 2 (E), FASTA

>1JWL_2 5'-D(*TP*AP*AP*TP*TP*GP*TP*TP*AP*TP*CP*CP*GP*CP*TP*CP*AP*CP*AP*AP*TP*TP*C)-3' (chains E)
TAATTGTTATCCGCTCACAATTC

Sequence of entity 3 (A, B, C), FASTA

>1JWL_3 Lactose Operon Repressor (chains A, B, C)
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQ
SLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGVEACKTAVHNLLAQRVS
GLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSHEDGTRLGVEHLVALGHQ
QIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPT
AMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTS
VDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPN

Ligands and cofactors

ID	Name	Formula	Copies
NPF	2-nitrophenyl beta-D-fucopyranoside	C12 H15 N O7	3

Primary citation

Crystallographic analysis of Lac repressor bound to natural operator O1. Bell, C.E., Lewis, M. J Mol Biol (2001) 312:921-926. DOI 10.1006/jmbi.2001.5024 · PubMed

Other PDB entries of the same protein (UniProt P03023 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8GOH 1.1 Å, Homotetramic Antiparallel Coiled-Coil of 23-residues LacI C-terminal tetramerization helix
1JYE 1.7 Å, Structure of a Dimeric Lac Repressor with C-terminal Deletion and K84L Substitution
2P9H 2.0 Å, High resolution structure of the Lactose Repressor bound to IPTG
3EDC 2.1 Å, Crystal Structure of a 1.6-hexanediol Bound Tetrameric Form of Escherichia coli…
1EFA 2.6 Å, Crystal structure of the lac repressor dimer bound to operator and the anti-inducer onpf
1TLF 2.6 Å, Unprecedented quaternary structure of E. Coli lac repressor core tetramer: implications…
1LBI 2.7 Å, Lac repressor
4RZS 2.71 Å, Lac repressor engineered to bind sucralose, unliganded tetramer
1JYF 3.0 Å, Structure of the Dimeric Lac Repressor with an 11-residue C-terminal Deletion.
4RZT 3.1 Å, Lac repressor engineered to bind sucralose, sucralose-bound tetramer
1LBH 3.2 Å, Intact lactose operon repressor with gratuitous inducer iptg
2PAF 3.5 Å, Crystal Structure of the Lactose Repressor bound to anti-inducer ONPF in induced state

Browse structure collections

About this viewer

MolViewer shows 1JWL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.