1JYR: Xray Structure of Grb2 SH2 Domain

Xray Structure of Grb2 SH2 Domain Complexed with a Phosphorylated Peptide. Determined by X-ray diffraction at 1.55 Å resolution. Released 13 Mar 2002.

Method: X-ray diffraction
Resolution: 1.55 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 995
Mol. weight: 12.14 kDa
Released: 13 Mar 2002

Explore 1JYR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JYR contains 3 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	61	1	1
α-helix	67-75	9
β-strand	82	1	2
β-strand	83-87	5	1
β-strand	95-101	7	1
β-strand	104-109	6	1
α-helix	110	1
β-strand	111-112	2	3
β-strand	118-119	2	3
β-strand	124-125	2	3
α-helix	128-134	7
β-strand	149	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Growth factor receptor-bound protein 2	A	protein	96	Homo sapiens	P62993 (AlphaFold model)
peptide: PSpYVNVQN	L	protein	9	synthetic construct

Sequence of entity 1 (A), FASTA

>1JYR_1 GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2 (chains A)
GSMAWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGA
GKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDI

Sequence of entity 2 (L), FASTA

>1JYR_2 peptide: PSpYVNVQN (chains L)
APSYVNVQN

Primary citation

Crystal structures of the SH2 domain of Grb2: highlight on the binding of a new high-affinity inhibitor. Nioche, P., Liu, W.Q., Broutin, I. et al. J Mol Biol (2002) 315:1167-1177. DOI 10.1006/jmbi.2001.5299 · PubMed

Other PDB entries of the same protein (UniProt P62993 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ICG 1.15 Å, Grb2 SH2 domain in phosphopeptide free form
3WA4 1.35 Å, Grb2 SH2 domain/CD28-derived peptide complex
2VWF 1.58 Å, Grb2 SH3C (2)
2VVK 1.6 Å, Grb2 SH3C (1)
3OV1 1.6 Å, Crystal Structure of the Grb2 SH2 Domain in Complex with a pYXN-Derived Tripeptide
4P9V 1.64 Å, Grb2 SH2 complexed with a pTyr-Ac6cN-Asn tripeptide
1GCQ 1.68 Å, Crystal structure of vav and GRB2 SH3 domains
2W0Z 1.7 Å, Grb2 SH3C (3)
3C7I 1.7 Å, X-RAY crystal structure of the complex between the grb2-sh2 domain and a flexible…
3IN8 1.7 Å, Crystal Structure of the Grb2 SH2 Domain in Complex with a Flexible Ac-pTyr-Ile-Asn-NH2…
3S8L 1.71 Å, Protein-Ligand Interactions: Thermodynamic Effects Associated with Increasing…
3S8N 1.71 Å, Crystal Structure of the Grb2 SH2 Domain in Complex with a pYXN-Derived Tripeptide

Browse structure collections

About this viewer

MolViewer shows 1JYR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.