3WA4: Grb2 SH2 domain/CD28-derived peptide complex

Grb2 SH2 domain/CD28-derived peptide complex. Determined by X-ray diffraction at 1.35 Å resolution. Released 26 Feb 2014.

Method: X-ray diffraction
Resolution: 1.35 Å
Organism: Homo sapiens
Chains: 2
Atoms: 937
Mol. weight: 12.58 kDa
Ligands: CD
Released: 26 Feb 2014

Explore 3WA4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3WA4 contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	61	1	1
α-helix	67-75	9
β-strand	82-87	6	1
β-strand	95-101	7	1
β-strand	104-110	7	1
β-strand	111-112	2	2
β-strand	118-119	2	2
β-strand	124-125	2	2
α-helix	128-134	7
β-strand	149-150	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Growth factor receptor-bound protein 2	A	protein	98	Homo sapiens	P62993 (AlphaFold model)
T-cell-specific surface glycoprotein CD28	B	protein	8	Homo sapiens	P10747 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3WA4_1 Growth factor receptor-bound protein 2 (chains A)
GSPEFWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDG
AGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIE

Sequence of entity 2 (B), FASTA

>3WA4_2 T-cell-specific surface glycoprotein CD28 (chains B)
SDYMNMTP

Ligands and cofactors

ID	Name	Formula	Copies
CD	Cadmium ion	Cd	1

Water and common crystallization additives (ACY) are not listed.

Primary citation

High Resolution Crystal Structure of the Grb2 SH2 Domain with a Phosphopeptide Derived from CD28. Higo, K., Ikura, T., Oda, M. et al. PLoS One (2013) 8:e74482-e74482. DOI 10.1371/journal.pone.0074482 · PubMed

Other PDB entries of the same protein (UniProt P62993 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ICG 1.15 Å, Grb2 SH2 domain in phosphopeptide free form
1JYR 1.55 Å, Xray Structure of Grb2 SH2 Domain Complexed with a Phosphorylated Peptide
2VWF 1.58 Å, Grb2 SH3C (2)
2VVK 1.6 Å, Grb2 SH3C (1)
3OV1 1.6 Å, Crystal Structure of the Grb2 SH2 Domain in Complex with a pYXN-Derived Tripeptide
4P9V 1.64 Å, Grb2 SH2 complexed with a pTyr-Ac6cN-Asn tripeptide
1GCQ 1.68 Å, Crystal structure of vav and GRB2 SH3 domains
2W0Z 1.7 Å, Grb2 SH3C (3)
3C7I 1.7 Å, X-RAY crystal structure of the complex between the grb2-sh2 domain and a flexible…
3IN8 1.7 Å, Crystal Structure of the Grb2 SH2 Domain in Complex with a Flexible Ac-pTyr-Ile-Asn-NH2…
3S8L 1.71 Å, Protein-Ligand Interactions: Thermodynamic Effects Associated with Increasing…
3S8N 1.71 Å, Crystal Structure of the Grb2 SH2 Domain in Complex with a pYXN-Derived Tripeptide

Browse structure collections

About this viewer

MolViewer shows 3WA4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.