1K0P: Zinc Finger Domain of Human DNA Polymerase-alpha

NMR Structures of the Zinc Finger Domain of Human DNA Polymerase-alpha. Determined by solution NMR. Released 24 Jun 2003.

Method
Solution NMR
Chains
1
Atoms
242
Mol. weight
3.54 kDa
Released
24 Jun 2003

Explore 1K0P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1K0P contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

ElementResiduesLengthSheet
α-helix4-129

Molecules and chains

MoleculeChainsTypeLengthOrganismUniProt
DNA polymerase alpha catalytic subunitAprotein31P09884 (AlphaFold model)
Sequence of entity 1 (A), FASTA
>1K0P_1 DNA polymerase alpha catalytic subunit (chains A)
ICEEPTCRNRTRHLPLQFSRTGPLCPACMKA

Primary citation

Nuclear magnetic resonance structures of the zinc finger domain of human DNA polymerase-alpha. Evanics, F., Maurmann, L., Yang, W.W. et al. Biochim Biophys Acta (2003) 1651:163-171. DOI 10.1016/S1570-9639(03)00266-8 · PubMed

Other PDB entries of the same protein (UniProt P09884 (AlphaFold model), which also has an AlphaFold model), best resolution first:

Browse structure collections

About this viewer

MolViewer shows 1K0P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.