8QJ7: DNA primase small subunit

Cryo-EM structure of human DNA polymerase alpha-primase in pre-initiation stage 1. Determined by electron microscopy at 3.07 Å resolution. Released 21 Feb 2024.

Method: Electron microscopy
Resolution: 3.07 Å
Organism: Homo sapiens
Chains: 4
Atoms: 18,912
Mol. weight: 342.18 kDa
Ligands: ZN, MN, ATP, SF4
Released: 21 Feb 2024

Explore 8QJ7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8QJ7 contains 124 α-helices and 99 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 58 helices, 46 β-strands

Element	Residues	Length	Sheet
β-strand	340-350	11	4
β-strand	359-367	9	4
β-strand	372-380	9	4
β-strand	384-391	8	5
α-helix	392	1
β-strand	394-396	3	6
β-strand	403-407	5	6
α-helix	410-416	7
α-helix	417-421	5
α-helix	422-425	4
β-strand	431-436	6	5
β-strand	438	1	7
β-strand	451-458	8	5
α-helix	462-465	4
β-strand	473-477	5	5
α-helix	483-490	8
β-strand	498-502	5	4
β-strand	505	1	4
β-strand	512	1	8
β-strand	516-520	5	4
α-helix	523-525	3
β-strand	526-528	3	4
α-helix	533-536	4
β-strand	537-548	12	9
β-strand	555-568	14	9
α-helix	573-575	3
β-strand	581-586	6	9
α-helix	593-595	3
α-helix	598-605	8
β-strand	610-611	2	9
α-helix	615-629	15
β-strand	633-636	4	9
α-helix	639-643	5
α-helix	644-654	11
α-helix	659-662	4
β-strand	665	1	8
α-helix	670-671	2
α-helix	683-685	3
β-strand	689-692	4	9
α-helix	693-700	8
α-helix	708-716	9
α-helix	727-729	3
α-helix	731-733	3
α-helix	735-758	24
α-helix	761-772	12
α-helix	776-780	5
α-helix	784-798	15
β-strand	801	1	7
α-helix	803-807	5
α-helix	845-847	3
β-strand	850-852	3	10
β-strand	856-859	4	10
α-helix	864-872	9
α-helix	901-903	3
α-helix	907-908	2
α-helix	910-930	21
α-helix	936-960	25
α-helix	970-993	24
β-strand	997-1001	5	10
β-strand	1006-1009	4	10
α-helix	1015-1032	18
β-strand	1040-1051	12	10
β-strand	1054-1062	9	10
α-helix	1064-1066	3
β-strand	1068-1075	8	10
α-helix	1086-1099	14
α-helix	1105-1124	20
α-helix	1130-1133	4
β-strand	1135-1138	4	11
α-helix	1143-1145	3
α-helix	1153-1164	12
β-strand	1174-1177	4	11
β-strand	1178	1	12
β-strand	1180-1181	2	13
α-helix	1188-1191	4
β-strand	1193	1	12
α-helix	1195-1200	6
β-strand	1205-1206	2	13
α-helix	1208-1211	4
α-helix	1212-1216	5
α-helix	1217-1224	8
α-helix	1232-1239	8
α-helix	1243-1248	6
α-helix	1269-1272	4
α-helix	1277-1278	2
β-strand	1279-1282	4	14
β-strand	1289-1292	4	14
β-strand	1296-1297	2	15
α-helix	1300-1302	3
β-strand	1304-1305	2	15
α-helix	1319-1322	4
α-helix	1323-1342	20
β-strand	1346-1348	3	16
β-strand	1356-1357	2	16
β-strand	1364	1	17
β-strand	1369	1	17
α-helix	1370-1371	2
β-strand	1379-1381	3	16
α-helix	1385-1398	14
α-helix	1401-1404	4
α-helix	1411-1420	10
α-helix	1424-1442	19
β-strand	1448-1450	3	18
α-helix	1451-1455	5

Chain B: 15 helices, 37 β-strands

Element	Residues	Length	Sheet
α-helix	161-163	3
β-strand	170-175	6	19
β-strand	193-195	3	20
α-helix	199-201	3
α-helix	213-235	23
β-strand	247	1	21
β-strand	253-259	7	22
β-strand	270-273	4	22
α-helix	276-279	4
β-strand	283-287	5	22
β-strand	295-296	2	23
β-strand	301-304	4	22
β-strand	307	1	22
β-strand	308	1	21
β-strand	314-315	2	22
β-strand	319	1	22
α-helix	321-326	6
α-helix	332-335	4
β-strand	340-346	7	19
α-helix	358-370	13
β-strand	374-378	5	19
β-strand	383	1	24
α-helix	387-390	4
α-helix	398-412	15
β-strand	419-423	5	19
β-strand	428	1	24
β-strand	435	1	25
β-strand	437	1	26
α-helix	438-440	3
α-helix	447-452	6
β-strand	453-455	3	19
β-strand	458	1	26
β-strand	460	1	27
β-strand	462-464	3	20
β-strand	467-468	2	20
β-strand	469-471	3	27
α-helix	476-482	7
β-strand	485-486	2	23
α-helix	494-505	12
β-strand	507	1	28
β-strand	520	1	25
α-helix	522-528	7
β-strand	530	1	28
β-strand	537-539	3	27
α-helix	545-546	2
β-strand	547-551	5	27
β-strand	554-558	5	27
β-strand	561	1	19
β-strand	563-564	2	29
β-strand	567-568	2	29
β-strand	570-576	7	19
β-strand	590-597	8	19

Chain C: 26 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	9-19	11
α-helix	23-31	9
α-helix	32-34	3
α-helix	39-42	4
β-strand	43-48	6	1
α-helix	50-52	3
β-strand	54-58	5	1
α-helix	63-73	11
β-strand	77-84	8	1
α-helix	88-93	6
β-strand	101-103	3	1
β-strand	106-111	6	2
α-helix	113-118	6
α-helix	129-144	16
α-helix	145-150	6
β-strand	155-159	5	2
β-strand	164-169	6	2
α-helix	174-176	3
α-helix	179-188	10
α-helix	208-209	2
α-helix	210-225	16
α-helix	226-231	6
α-helix	237-245	9
α-helix	249-261	13
α-helix	265-278	14
α-helix	291-301	11
α-helix	307-311	5
β-strand	317-318	2	1
α-helix	319	1
β-strand	323	1	3
β-strand	330	1	3
β-strand	333	1	2
α-helix	334-335	2
α-helix	348-349	2
α-helix	350-357	8
α-helix	383-385	3
α-helix	388-405	18

Chain D: 25 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	36-38	3	18
α-helix	39-62	24
α-helix	68-81	14
α-helix	89-110	22
α-helix	114-134	21
α-helix	137-146	10
β-strand	152-153	2	30
α-helix	154-155	2
α-helix	156-161	6
α-helix	163-169	7
β-strand	184-187	4	30
α-helix	188-191	4
α-helix	192-195	4
β-strand	201-203	3	30
β-strand	206-209	4	30
α-helix	211-240	30
α-helix	247-250	4
α-helix	276-282	7
α-helix	286-298	13
α-helix	303-316	14
α-helix	320-332	13
α-helix	338-341	4
α-helix	342-346	5
α-helix	347-353	7
α-helix	367-372	6
α-helix	385-388	4
α-helix	391-400	10
α-helix	405-416	12
α-helix	420-431	12
α-helix	444-454	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA primase small subunit	C	protein	420	Homo sapiens	P49642 (AlphaFold model)
DNA polymerase alpha catalytic subunit	A	protein	1462	Homo sapiens	P09884 (AlphaFold model)
DNA polymerase alpha subunit B	B	protein	598	Homo sapiens	Q14181 (AlphaFold model)
DNA primase large subunit	D	protein	509	Homo sapiens	P49643 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>8QJ7_1 DNA primase small subunit (chains C)
METFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSF
NNQSDLEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRR
CCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSA
VRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENKESW
DKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQY
CFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAI
STNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF

Sequence of entity 2 (A), FASTA

>8QJ7_2 DNA polymerase alpha catalytic subunit (chains A)
MAPVHGDDSLSDSGSFVSSRARREKKSKKGRQEALERLKKAKAGEKYKYEVEDFTGVYEE
VDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDADEKGKDGKARNKDK
RNVKKLAVTKPNNIKSMFIACAGKKTADKAVDLSKDGLLGDILQDLNTETPQITPPPVMI
LKKKRSIGASPNPFSVHTATAVPSGKIASPVSRKEPPLTPVPLKRAEFAGDDVQVESTEE
EQESGAMEFEDGDFDEPMEVEEVDLEPMAAKAWDKESEPAEEVKQEADSGKGTVSYLGSF
LPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLVKGADEEQVFHFYWLDAYEDQYNQPGVVF
LFGKVWIESAETHVSCCVMVKNIERTLYFLPREMKIDLNTGKETGTPISMKDVYEEFDEK
IATKYKIMKFKSKPVEKNYAFEIPDVPEKSEYLEVKYSAEMPQLPQDLKGETFSHVFGTN
TSSLELFLMNRKIKGPCWLEVKSPQLLNQPVSWCKVEAMALKPDLVNVIKDVSPPPLVVM
AFSMKTMQNAKNHQNEIIAMAALVHHSFALDKAAPKPPFQSHFCVVSKPKDCIFPYAFKE
VIEKKNVKVEVAATERTLLGFFLAKVHKIDPDIIVGHNIYGFELEVLLQRINVCKAPHWS
KIGRLKRSNMPKLGGRSGFGERNATCGRMICDVEISAKELIRCKSYHLSELVQQILKTER
VVIPMENIQNMYSESSQLLYLLEHTWKDAKFILQIMCELNVLPLALQITNIAGNIMSRTL
MGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDEDEEIDGDTNKYKKGRKKAAYA
GGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRVASEAQKVTEDGEQEQIPE
LPDPSLEMGILPREIRKLVERRKQVKQLMKQQDLNPDLILQYDIRQKALKLTANSMYGCL
GFSYSRFYAKPLAALVTYKGREILMHTKEMVQKMNLEVIYGDTDSIMINTNSTNLEEVFK
LGNKVKSEVNKLYKLLEIDIDGVFKSLLLLKKKKYAALVVEPTSDGNYVTKQELKGLDIV
RRDWCDLAKDTGNFVIGQILSDQSRDTIVENIQKRLIEIGENVLNGSVPVSQFEINKALT
KDPQDYPDKKSLPHVHVALWINSQGGRKVKAGDTVSYVICQDGSNLTASQRAYAPEQLQK
QDNLTIDTQYYLAQQIHPVVARICEPIDGIDAVLIATWLGLDPTQFRVHHYHKDEENDAL
LGGPAQLTDEEKYRDCERFKCPCPTCGTENIYDNVFDGSGTDMEPSLYRCSNIDCKASPL
TFTVQLSNKLIMDIRRFIKKYYDGWLICEEPTCRNRTRHLPLQFSRTGPLCPACMKATLQ
PEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQF
LSRSGYSEVNLSKLFAGCAVKS

Sequence of entity 3 (B), FASTA

>8QJ7_3 DNA polymerase alpha subunit B (chains B)
MSASAQQLAEELQIFGLDCEEALIEKLVELCVQYGQNEEGMVGELIAFCTSTHKVGLTSE
ILNSFEHEFLSKRLSKARHSTCKDSGHAGARDIVSIQELIEVEEEEEILLNSYTTPSKGS
QKRAISTPETPLTKRSVSTRSPHQLLSPSSFSPSATPSQKYNSRSNRGEVVTSFGLAQGV
SWSGRGGAGNISLKVLGCPEALTGSYKSMFQKLPDIREVLTCKIEELGSELKEHYKIEAF
TPLLAPAQEPVTLLGQIGCDSNGKLNNKSVILEGDREHSSGAQIPVDLSELKEYSLFPGQ
VVIMEGINTTGRKLVATKLYEGVPLPFYQPTEEDADFEQSMVLVACGPYTTSDSITYDPL
LDLIAVINHDRPDVCILFGPFLDAKHEQVENCLLTSPFEDIFKQCLRTIIEGTRSSGSHL
VFVPSLRDVHHEPVYPQPPFSYSDLSREDKKQVQFVSEPCSLSINGVIFGLTSTDLLFHL
GAEEISSSSGTSDRFSRILKHILTQRSYYPLYPPQEDMAIDYESFYVYAQLPVTPDVLII
PSELRYFVKDVLGCVCVNPGRLTKGQVGGTFARLYLRRPAADGAERQSPCIAVQVVRI

Sequence of entity 4 (D), FASTA

>8QJ7_4 DNA primase large subunit (chains D)
MEFSGRKWRKLRLAGDQRNASYPHCLQFYLQPPSENISLIEFENLAIDRVKLLKSVENLG
VSYVKGTEQYQSKLESELRKLKFSYRENLEDEYEPRRRDHISHFILRLAYCQSEELRRWF
IQQEMDLLRFRFSILPKDKIQDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGF
ESIYKIPFADALDLFRGRKVYLEDGFAYVPLKDIVAIILNEFRAKLSKALALTARSLPAV
QSDERLQPLLNHLSHSYTGQDYSTQGNVGKISLDQIDLLSTKSFPPCMRQLHKALRENHH
LRHGGRMQYGLFLKGIGLTLEQALQFWKQEFIKGKMDPDKFDKGYSYNIRHSFGKEGKRT
DYTPFSCLKIILSNPPSQGDYHGCPFRHSDPELLKQKLQSYKISPGGISQILDLVKGTHY
QVACQKYFEMIHNVDDCGFSLNHPNQFFCESQRILNGGKDIKKEPIQPETPQPKPSVQKT
KDASSALASLNSSLEMDMEGLEDYFSEDS

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3
MN	Manganese (II) ion	Mn	2
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1
SF4	Iron/sulfur cluster	Fe4 S4	1

Primary citation

CryoEM insights into RNA primer synthesis by the human primosome. Yin, Z., Kilkenny, M.L., Ker, D.S. et al. FEBS J (2024) 291:1813-1829. DOI 10.1111/febs.17082 · PubMed

Other PDB entries of the same protein (UniProt P49642 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6RB4 1.5 Å, Crystal structure of the Pri1 subunit of human primase
4LIK 1.7 Å, Crystal structure of the catalytic subunit of human primase
6R5E 1.85 Å, Crystal structure of the Pri1 subunit of human primase bound to 2F-ATP
6R5D 1.95 Å, Crystal structure of the Pri1 subunit of human primase bound to dATP
4MHQ 2.2 Å, Crystal structure of human primase catalytic subunit
6R4U 2.2 Å, Crystal structure of the Pri1 subunit of human primase bound to fludarabine triphosphate
6R4T 2.35 Å, Crystal structure of the Pri1 subunit of human primase bound to vidarabine triphosphate
4LIL 2.6 Å, Crystal structure of the catalytic subunit of human primase bound to UTP and Mn
4RR2 2.65 Å, Crystal structure of human primase
4BPU 2.7 Å, Crystal structure of human primase in heterodimeric form, comprising PriS and truncated…
6R4S 2.75 Å, Crystal structure of the Pri1 subunit of human primase bound to ATP
8VY3 2.98 Å, Human DNA polymerase alpha/primase - AavLEA1 (1:40 molar ratio)

Browse structure collections

About this viewer

MolViewer shows 8QJ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.