8D0B: CST complex subunit CTC1

Human CST-DNA polymerase alpha/primase preinitiation complex bound to 4xTEL-foldback template. Determined by electron microscopy at 3.43 Å resolution. Released 22 Jun 2022.

Method: Electron microscopy
Resolution: 3.43 Å
Organism: Homo sapiens
Chains: 8
Atoms: 29,367
Mol. weight: 452.79 kDa
Released: 22 Jun 2022

Explore 8D0B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8D0B contains 174 α-helices and 191 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 42 helices, 81 β-strands

Element	Residues	Length	Sheet
α-helix	10-26	17
α-helix	38-52	15
β-strand	66-67	2	1
α-helix	70-76	7
β-strand	81-84	4	2
α-helix	89-99	11
α-helix	104	1
β-strand	105	1	3
α-helix	106-107	2
β-strand	108-109	2	2
β-strand	111-112	2	1
β-strand	114-118	5	4
β-strand	134-136	3	4
β-strand	141-143	3	4
β-strand	144-145	2	2
α-helix	151-153	3
β-strand	157-159	3	4
β-strand	162-166	5	2
β-strand	178-180	3	2
α-helix	184-185	2
β-strand	186-187	2	4
α-helix	193-195	3
α-helix	206-214	9
β-strand	224-233	10	5
β-strand	237-238	2	6
β-strand	243-244	2	6
β-strand	245-250	6	5
β-strand	258-263	6	5
α-helix	267-273	7
β-strand	280-290	11	5
β-strand	297-301	5	5
β-strand	307-309	3	5
β-strand	351-352	2	7
β-strand	354-356	3	8
β-strand	359-367	9	8
β-strand	372-375	4	8
β-strand	379-382	4	8
β-strand	399-404	6	8
β-strand	406-409	4	8
β-strand	413	1	9
β-strand	416	1	9
β-strand	420-421	2	8
β-strand	428-433	6	8
β-strand	437	1	3
α-helix	438-440	3
α-helix	442-444	3
α-helix	450-458	9
α-helix	464-481	18
α-helix	488-491	4
α-helix	502-514	13
α-helix	519-522	4
α-helix	524-528	5
β-strand	539-540	2	7
β-strand	547-548	2	10
α-helix	552-565	14
α-helix	569-572	4
α-helix	577-580	4
α-helix	583-589	7
β-strand	592-597	6	11
β-strand	605-606	2	10
β-strand	608-614	7	12
β-strand	621-624	4	12
β-strand	629-631	3	12
β-strand	632-636	5	11
β-strand	640-641	2	11
α-helix	645-647	3
β-strand	651-654	4	12
β-strand	658-667	10	11
β-strand	681-693	13	11
β-strand	697-700	4	12
β-strand	729-730	2	13
β-strand	731-738	8	14
β-strand	742-744	3	15
β-strand	746	1	16
α-helix	747-749	3
α-helix	756-759	4
β-strand	760-762	3	15
β-strand	763-769	7	14
β-strand	774-775	2	13
β-strand	776-777	2	17
β-strand	780-781	2	17
α-helix	782-788	7
β-strand	796-800	5	14
α-helix	802-810	9
β-strand	816-819	4	14
β-strand	842	1	16
α-helix	843-845	3
β-strand	860-862	3	14
α-helix	869-872	4
α-helix	878-879	2
α-helix	883-886	4
β-strand	896-908	13	18
β-strand	928-935	8	18
α-helix	943-944	2
β-strand	945-950	6	18
α-helix	952-954	3
α-helix	957-958	2
β-strand	966-976	11	18
β-strand	982-985	4	18
β-strand	991-996	6	18
α-helix	997-999	3
α-helix	1006-1008	3
β-strand	1009	1	19
α-helix	1014-1016	3
β-strand	1024-1027	4	19
β-strand	1030-1043	14	19
β-strand	1049	1	19
β-strand	1050	1	20
β-strand	1055	1	20
β-strand	1058	1	21
β-strand	1062	1	21
β-strand	1067-1078	12	19
β-strand	1083-1089	7	19
α-helix	1091-1097	7
α-helix	1101-1111	11
β-strand	1117-1120	4	19
α-helix	1137-1147	11
β-strand	1154	1	19
β-strand	1156-1161	6	19
β-strand	1175-1177	3	22
β-strand	1188-1190	3	22
α-helix	1191-1193	3
β-strand	1194-1202	9	19

Chain B: 21 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	10-13	4
α-helix	17-19	3
α-helix	21-24	4
β-strand	27-28	2	23
α-helix	31-36	6
α-helix	37	1
β-strand	38-39	2	24
α-helix	40	1
β-strand	47-49	3	24
β-strand	52-54	3	24
β-strand	56-68	13	23
β-strand	72-78	7	23
β-strand	83-89	7	23
α-helix	90-92	3
α-helix	96-99	4
α-helix	104-123	20
β-strand	131-140	10	23
β-strand	145-154	10	23
α-helix	162-173	12
α-helix	174-178	5
α-helix	201-219	19
β-strand	223-225	3	25
α-helix	226-231	6
α-helix	233-239	7
α-helix	242-246	5
α-helix	255-277	23
β-strand	280-281	2	25
β-strand	290-293	4	25
α-helix	294-296	3
α-helix	298-309	12
α-helix	319	1
β-strand	322-323	2	26
α-helix	324-334	11
α-helix	341-353	13
β-strand	358	1	27
β-strand	364-365	2	26
β-strand	366	1	27

Chain C: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	4-6	3
β-strand	8-9	2	28
α-helix	12-15	4
β-strand	25-36	12	28
β-strand	41-48	8	28
β-strand	51-58	8	28
β-strand	72-81	10	28
β-strand	87-96	10	28
α-helix	102-120	19

Chain D: 29 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
α-helix	9-15	7
α-helix	16-20	5
α-helix	23-29	7
α-helix	32-34	3
α-helix	40-42	3
β-strand	43-49	7	29
β-strand	53-58	6	29
α-helix	63-73	11
β-strand	77	1	29
β-strand	79-84	6	29
α-helix	88-90	3
β-strand	101-103	3	29
β-strand	106-110	5	30
α-helix	112-114	3
α-helix	132-144	13
α-helix	145-150	6
β-strand	155-159	5	30
β-strand	165-169	5	30
α-helix	179-188	10
α-helix	210-223	14
α-helix	224-231	8
α-helix	237-243	7
α-helix	244-246	3
α-helix	249-251	3
α-helix	252-261	10
α-helix	265-280	16
α-helix	292-301	10
α-helix	307-311	5
β-strand	317-318	2	29
α-helix	319	1
β-strand	323	1	31
β-strand	329	1	32
β-strand	330	1	31
α-helix	332	1
β-strand	333-334	2	30
α-helix	335	1
α-helix	344-346	3
α-helix	348	1
β-strand	349	1	32
α-helix	350-367	18
α-helix	375-385	11
α-helix	389-417	29

Chain E: 15 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	17-21	5
α-helix	32-33	2
β-strand	36-37	2	33
α-helix	39-62	24
α-helix	69-80	12
α-helix	93-109	17
α-helix	114-133	20
α-helix	137-146	10
β-strand	153	1	34
α-helix	156-161	6
α-helix	163-169	7
β-strand	184-187	4	34
α-helix	192-196	5
β-strand	201-203	3	34
β-strand	206-209	4	34
α-helix	211-213	3
α-helix	214-218	5
α-helix	219-235	17
α-helix	238-240	3
α-helix	247-254	8

Chain F: 45 helices, 39 β-strands

Element	Residues	Length	Sheet
β-strand	332-333	2	35
β-strand	339-350	12	35
β-strand	359-367	9	35
β-strand	372-380	9	35
α-helix	383	1
β-strand	384-391	8	36
β-strand	394-396	3	37
β-strand	403-407	5	37
α-helix	410-416	7
α-helix	417-421	5
α-helix	422-425	4
β-strand	431-438	8	36
β-strand	449-458	10	36
α-helix	462-465	4
β-strand	473-477	5	36
α-helix	483-490	8
β-strand	498-502	5	35
β-strand	505	1	35
β-strand	512	1	38
β-strand	516-520	5	35
α-helix	523-525	3
β-strand	526-529	4	35
α-helix	533-536	4
β-strand	537-548	12	39
β-strand	555-568	14	39
α-helix	573-575	3
β-strand	581-586	6	39
α-helix	594-595	2
α-helix	598-605	8
β-strand	609-611	3	39
α-helix	615-629	15
β-strand	633-636	4	39
α-helix	639-643	5
α-helix	644-654	11
α-helix	659-662	4
β-strand	665	1	38
α-helix	670-672	3
α-helix	679-683	5
β-strand	689-692	4	39
α-helix	693-700	8
α-helix	708-711	4
α-helix	712-716	5
α-helix	725-730	6
α-helix	735-758	24
α-helix	761-772	12
α-helix	776-779	4
α-helix	784-797	14
α-helix	803-805	3
β-strand	844	1	40
β-strand	856-861	6	40
α-helix	864-872	9
α-helix	899-903	5
α-helix	907-908	2
α-helix	910-929	20
α-helix	936-961	26
α-helix	970-993	24
β-strand	997-1002	6	40
β-strand	1005-1009	5	40
α-helix	1015-1032	18
β-strand	1038-1049	12	40
β-strand	1055-1062	8	40
β-strand	1068-1074	7	40
α-helix	1269-1272	4
α-helix	1277-1278	2
β-strand	1279-1282	4	41
β-strand	1289-1292	4	41
β-strand	1296	1	42
β-strand	1305	1	42
α-helix	1319-1322	4
α-helix	1323-1342	20
β-strand	1346-1348	3	43
β-strand	1356-1357	2	43
α-helix	1369	1
β-strand	1370	1	44
α-helix	1371	1
β-strand	1378	1	44
β-strand	1379-1381	3	43
α-helix	1385-1397	13
α-helix	1401-1406	6
α-helix	1411-1420	10
α-helix	1424-1441	18
α-helix	1445-1447	3
β-strand	1449-1450	2	33
α-helix	1451-1454	4

Chain G: 19 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	148-151	4
α-helix	159-162	4
β-strand	170-175	6	45
β-strand	193-196	4	46
α-helix	213-235	23
β-strand	250-259	10	47
β-strand	270-274	5	47
α-helix	276-279	4
β-strand	283-287	5	47
β-strand	294-296	3	48
β-strand	301-307	7	47
β-strand	314-319	6	47
α-helix	320-322	3
α-helix	324-326	3
β-strand	327	1	49
α-helix	328	1
α-helix	332-336	5
β-strand	339-345	7	45
α-helix	358-370	13
β-strand	374-378	5	45
β-strand	383	1	50
α-helix	387-390	4
α-helix	398-413	16
β-strand	419-423	5	45
β-strand	428	1	50
β-strand	435	1	51
β-strand	437	1	52
α-helix	438-440	3
α-helix	447-450	4
β-strand	453-455	3	45
β-strand	458	1	52
β-strand	460-464	5	46
β-strand	467-471	5	46
α-helix	476-482	7
β-strand	485-487	3	48
α-helix	494-504	11
α-helix	514-515	2
β-strand	520	1	51
α-helix	522-528	7
β-strand	534	1	49
β-strand	537-539	3	46
β-strand	547-551	5	46
β-strand	554-558	5	46
β-strand	563-564	2	53
β-strand	567-568	2	53
β-strand	570-577	8	45
α-helix	578-580	3
α-helix	586-588	3
β-strand	590-597	8	45

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CST complex subunit CTC1	A	protein	1209	Homo sapiens	Q2NKJ3 (AlphaFold model)
CST complex subunit STN1	B	protein	362	Homo sapiens	Q9H668 (AlphaFold model)
CST complex subunit TEN1	C	protein	121	Homo sapiens	Q86WV5 (AlphaFold model)
DNA primase small subunit	D	protein	419	Homo sapiens	P49642 (AlphaFold model)
DNA primase large subunit	E	protein	241	Homo sapiens	P49643
DNA polymerase alpha catalytic subunit	F	protein	1139	Homo sapiens	P09884
DNA polymerase alpha subunit B	G	protein	456	Homo sapiens	Q14181
DNA (5'-d(ptpapgpgpgptptpapgpgpgptptpap*g)-3')	H	DNA	15	Homo sapiens

Sequence of entity 1 (A), FASTA

>8D0B_1 CST complex subunit CTC1 (chains A)
PSSEQAWLEDAQVFIQKTLCPAVKEPNVQLTPLVIDCVKTVWLSQGRNQGSTLPLSYSFV
SVQDLKTHQRLPCCSHLSWSSSAYQAWAQEAGPNGNPLPREQLLLLGTLTDLSADLEQEC
RNGSLYVRDNTGVLSCELIDLDLSWLGHLFLFPRWSYLPPARWNSSGEGHLELWDAPVPV
FPLTISPGPVTPIPVLYPESASCLLRLRNKLRGVQRNLAGSLVRLSALVKSKQKAYFILS
LGRSHPAVTHVSIIVQVPAQLVWHRALRPGTAYVLTELRVSKIRGQRQHVWMTSQSSRLL
LLKPECVQELELELEGPLLEADPKPLPMPSNSEDKKDPESLVRYSRLLSYSGAVTGVLNE
PAGLYELDGQLGLCLAYQQFRGLRRVMRPGVCLQLQDVHLLQSVGGGTRRPVLAPCLRGA
VLLQSFSRQKPGAHSSRQAYGASLYEQLVWERQLGLPLYLWATKALEELACKLCPHVLRH
HQFLQHSSPGSPSLGLQLLAPTLDLLAPPGSPVRNAHNEILEEPHHCPLQKYTRLQTPSS
FPTLATLKEEGQRKAWASFDPKALLPLPEASYLPSCQLNRRLAWSWLCLLPSAFCPAQVL
LGVLVASSHKGCLQLRDQSGSLPCLLLAKHSQPLSDPRLIGCLVRAERFQLIVERDVRSS
FPSWKELSMPGFIQKQQARVYVQFFLADALILPVPRPCLHSATPSTPQTDPTGPEGPHLG
QSRLFLLCHKEALMKRNFCVPPGASPEVPKPALSFYVLGSWLGGTQRKEGTGWGLPEPQG
NDDNDQKVHLIFFGSSVRWFEFLHPGQVYRLVAPGPATPMLFEKDGSSCISRRPLELAGC
ASCLTVQDNWTLELESSQDIQDVLDANKSLPESSLTDLLSDNFTDSLVSFSAEILSRTLC
EPLVASLWMKLGNTGAMRRCVKLTVALETAECEFPPHLDVYIEDPHLPPSLGLLPGARVH
FSQLEKRVSRSHNVYCCFRSSTYVQVLSFPPETTISVPLPHIYLAELLQGGQSPFQATAS
CHIVSVFSLQLFWVCAYCTSICRQGKCTRLGSTCPTQTAISQAIIRLLVEDGTAEAVVTC
RNHHVAAALGLCPREWASLLDFVQVPGRVVLQFAGPGAQLESSARVDEPMTMFLWTLCTS
PSVLRPIVLSFELERKPSKIVPLEPPRLQRFQCGELPFLTHVNPRLRLSCLSIRESEYSS
SLGILASSC

Sequence of entity 2 (B), FASTA

>8D0B_2 CST complex subunit STN1 (chains B)
RCEEETPSLLWGLDPVFLAFAKLYIRDILDMKESRQVPGVFLYNGHPIKQVDVLGTVIGV
RERDAFYSYGVDDSTGVINCICWKKLNTESVSAAPSAARELSLTSQLKKLQETIEQKTKI
EIGDTIRVRGSIRTYREEREIHATTYYKVDDPVWNIQIARMLELPTIYRKVYDQPFHSSA
LEKEEALSNPGALDLPSLTSLLSEKAKEFLMENRVQSFYQQELEMVESLLSLANQPVIHS
ASSDQVNFKKDTTSKAIHSIFKNAIQLLQEKGLVFQKDDGFDNLYYVTREDKDLHRKIHR
IIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQVLELLEDQSDIVSTMEHYYT
AF

Sequence of entity 3 (C), FASTA

>8D0B_3 CST complex subunit TEN1 (chains C)
LPKPGTYYLPWEVSAGQVPDGSTLRTFGRLCLYDMIQSRVTLMAQHGSDQHQVLVCTKLV
EPFHAQVGSLYIVLGELQHQQDRGSVVKARVLTCVEGMNLPLLEQAIREQRLYKQERGGS
Q

Sequence of entity 4 (D), FASTA

>8D0B_4 DNA primase small subunit (chains D)
ETFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFN
NQSDLEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRC
CSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAV
RSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENKESWD
KILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQYC
FPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAIS
TNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF

Sequence of entity 5 (E), FASTA

>8D0B_5 DNA primase large subunit (chains E)
DQRNASYPHCLQFYLQPPSENISLIEFENLAIDRVKLLKSVENLGVSYVKGTEQYQSKLE
SELRKLKFSYRENLEDEYEPRRRDHISHFILRLAYCQSEELRRWFIQQEMDLLRFRFSIL
PKDKIQDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGFESIYKIPFADALDLF
RGRKVYLEDGFAYVPLKDIVAIILNEFRAKLSKALALTARSLPAVQSDERLQPLLNHLSH
S

Sequence of entity 6 (F), FASTA

>8D0B_6 DNA polymerase alpha catalytic subunit (chains F)
VDSSHLPLVKGADEEQVFHFYWLDAYEDQYNQPGVVFLFGKVWIESAETHVSCCVMVKNI
ERTLYFLPREMKIDLNTGKETGTPISMKDVYEEFDEKIATKYKIMKFKSKPVEKNYAFEI
PDVPEKSEYLEVKYSAEMPQLPQDLKGETFSHVFGTNTSSLELFLMNRKIKGPCWLEVKS
PQLLNQPVSWCKVEAMALKPDLVNVIKDVSPPPLVVMAFSMKTMQNAKNHQNEIIAMAAL
VHHSFALDKAAPKPPFQSHFCVVSKPKDCIFPYAFKEVIEKKNVKVEVAATERTLLGFFL
AKVHKIDPDIIVGHNIYGFELEVLLQRINVCKAPHWSKIGRLKRSNMPKLGGRSGFGERN
ATCGRMICDVEISAKELIRCKSYHLSELVQQILKTERVVIPMENIQNMYSESSQLLYLLE
HTWKDAKFILQIMCELNVLPLALQITNIAGNIMSRTLMGGRSERNEFLLLHAFYENNYIV
PDKQIFRKPQQKLGDEDEEIDGDTNKYKKGRKKAAYAGGLVLDPKVGFYDKFILLLDFNS
LYPSIIQEFNICFTTVQRVASEAQKVTEDGEQEQIPELPDPSLEMGILPREIRKLVERRK
QVKQLMKQQDLNPDLILQYDIRQKALKLTANSMYGCLGFSYSRFYAKPLAALVTYKGREI
LMHTKEMVQKMNLEVIYGDTDSIMINTNSTNLEEVFKLGNKVKSEVNKLYKLLEIDIDGV
FKSLLLLKKKKYAALVVEPTSDGNYVTKQELKGLDIVRRDWCDLAKDTGNFVIGQILSDQ
SRDTIVENIQKRLIEIGENVLNGSVPVSQFEINKALTKDPQDYPDKKSLPHVHVALWINS
QGGRKVKAGDTVSYVICQDGSNLTASQRAYAPEQLQKQDNLTIDTQYYLAQQIHPVVARI
CEPIDGIDAVLIATWLGLDPTQFRVHHYHKDEENDALLGGPAQLTDEEKYRDCERFKCPC
PTCGTENIYDNVFDGSGTDMEPSLYRCSNIDCKASPLTFTVQLSNKLIMDIRRFIKKYYD
GWLICEEPTCRNRTRHLPLQFSRTGPLCPACMKATLQPEYSDKSLYTQLCFYRYIFDAEC
ALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQFLSRSGYSEVNLSKLFAGCAVKS

Sequence of entity 7 (G), FASTA

>8D0B_7 DNA polymerase alpha subunit B (chains G)
HQLLSPSSFSPSATPSQKYNSRSNRGEVVTSFGLAQGVSWSGRGGAGNISLKVLGCPEAL
TGSYKSMFQKLPDIREVLTCKIEELGSELKEHYKIEAFTPLLAPAQEPVTLLGQIGCDSN
GKLNNKSVILEGDREHSSGAQIPVDLSELKEYSLFPGQVVIMEGINTTGRKLVATKLYEG
VPLPFYQPTEEDADFEQSMVLVACGPYTTSDSITYDPLLDLIAVINHDRPDVCILFGPFL
DAKHEQVENCLLTSPFEDIFKQCLRTIIEGTRSSGSHLVFVPSLRDVHHEPVYPQPPFSY
SDLSREDKKQVQFVSEPCSLSINGVIFGLTSTDLLFHLGAEEISSSSGTSDRFSRILKHI
LTQRSYYPLYPPQEDMAIDYESFYVYAQLPVTPDVLIIPSELRYFVKDVLGCVCVNPGRL
TKGQVGGTFARLYLRRPAADGAERQSPCIAVQVVRI

Sequence of entity 8 (H), FASTA

>8D0B_8 DNA (5'-D(P*TP*AP*GP*GP*GP*TP*TP*AP*GP*GP*GP*TP*TP*AP*G)-3') (chains H)
TAGGGTTAGGGTTAG

Primary citation

Structures of the human CST-Pol alpha-primase complex bound to telomere templates. He, Q., Lin, X., Chavez, B.L. et al. Nature (2022) 608:826-832. DOI 10.1038/s41586-022-05040-1 · PubMed

Other PDB entries of the same protein (UniProt Q2NKJ3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W2L 1.86 Å, Structure of a central domain of human Ctc1
6W6W 3.0 Å, Cryo-EM structure of CST bound to telomeric single-stranded DNA
8SOJ 3.8 Å, Cryo-EM structure of human CST bound to POT1(ESDL)/TPP1 in the absence of telomeric ssDNA
8SOK 4.1 Å, Cryo-EM structure of human CST bound to POT1(ESDL)/TPP1 in the presence of telomeric ssDNA
8D0K 4.27 Å, Human CST-DNA polymerase alpha/primase preinitiation complex bound to 4xTEL-foldback…
7U5C 4.6 Å, Cryo-EM structure of human CST bound to DNA polymerase alpha-primase in a recruitment…

Browse structure collections

About this viewer

MolViewer shows 8D0B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.