1K18: DNA polymerase alpha catalytic subunit
Minimized Average NMR Structure of the Zinc Finger Domain of Human DNA Polymerase-alpha. Determined by solution NMR. Released 24 Jun 2003.
- Method
- Solution NMR
- Chains
- 1
- Atoms
- 242
- Mol. weight
- 3.54 kDa
- Released
- 24 Jun 2003
Explore 1K18 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1K18 contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-12 | 8 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| DNA polymerase alpha catalytic subunit | A | protein | 31 | | P09884 (AlphaFold model) |
Sequence of entity 1 (A), FASTA
>1K18_1 DNA POLYMERASE ALPHA CATALYTIC SUBUNIT (chains A)
ICEEPTCRNRTRHLPLQFSRTGPLCPACMKA
Primary citation
Nuclear magnetic resonance structures of the zinc finger domain of human DNA polymerase-alpha. Evanics, F., Maurmann, L., Yang, W.W. et al. Biochim Biophys Acta (2003) 1651:163-171. DOI 10.1016/S1570-9639(03)00266-8 · PubMed
Other PDB entries of the same protein (UniProt P09884 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 4QCL 2.2 Å, Crystal structure of the catalytic core of human DNA polymerase alpha in ternary complex…
- 4Y97 2.51 Å, Crystal Structure of human Pol alpha B-subunit in complex with C-terminal domain of…
- 4Q5V 2.52 Å, Crystal structure of the catalytic core of human DNA polymerase alpha in ternary complex…
- 7N2M 2.9 Å, Crystal structure of DNA polymerase alpha catalytic core in complex with dCTP and…
- 6AS7 2.95 Å, Crystal structure of the catalytic core of human DNA polymerase alpha in ternary complex…
- 8VY3 2.98 Å, Human DNA polymerase alpha/primase - AavLEA1 (1:40 molar ratio)
- 8QJ7 3.07 Å, Cryo-EM structure of human DNA polymerase alpha-primase in pre-initiation stage 1
- 5IUD 3.3 Å, Human DNA polymerase alpha in binary complex with a DNA:DNA template-primer
- 8D96 3.35 Å, Human DNA polymerase alpha/primase elongation complex I bound to primer/template
- 9C8V 3.39 Å, Human DNA polymerase alpha/primase - CHAPSO (4 mM)
- 8B9D 3.4 Å, Human replisome bound by Pol Alpha
- 8D0B 3.43 Å, Human CST-DNA polymerase alpha/primase preinitiation complex bound to 4xTEL-foldback…
Browse structure collections
About this viewer
MolViewer shows 1K18 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.