Solution structure of N-terminal SH3 domain mutant(P33G) of murine Vav. Determined by solution NMR. Released 10 Oct 2001.
Explore 1K1Z in 3D Show helices and sheets RCSB PDB PDBe
1K1Z contains 1 α-helix and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 15-17 | 3 | 1 |
| β-strand | 21 | 1 | 2 |
| α-helix | 26-27 | 2 | |
| β-strand | 37 | 1 | 2 |
| β-strand | 42-47 | 6 | 1 |
| β-strand | 55-59 | 5 | 1 |
| β-strand | 64-68 | 5 | 1 |
| β-strand | 73-75 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| vav | A | protein | 78 | Mus musculus | P27870 (AlphaFold model) |
>1K1Z_1 vav (chains A) RAQDKKRNELGLPKMEVFQEYYGIPPPPGAFGGFLRLNPGDIVELTKAEAEHNWWEGRNT ATNEVGWFPCNRVHPYVH
Solution structure of N-terminal SH3 domain of Vav and the recognition site for Grb2 C-terminal SH3 domain. Ogura, K., Nagata, K., Horiuchi, M. et al. J Biomol NMR (2002) 22:37-46. DOI 10.1023/A:1013868731495 · PubMed
Other PDB entries of the same protein (UniProt P27870 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1K1Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.