1KEB: Double Mutant M37L,P40S E.coli Thioredoxin

Crystal Structure of Double Mutant M37L,P40S E.coli Thioredoxin. Determined by X-ray diffraction at 1.8 Å resolution. Released 13 Nov 2002.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Escherichia coli
Chains: 2
Atoms: 1,777
Mol. weight: 23.45 kDa
Ligands: CU
Released: 13 Nov 2002

Explore 1KEB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KEB contains 12 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
α-helix	12	1
α-helix	13-17	5
β-strand	22-28	7	1
α-helix	33-39	7
α-helix	42-48	7
β-strand	54-59	6	1
α-helix	67-70	4
β-strand	77-82	6	1
β-strand	85-91	7	1
α-helix	96-106	11

Chain B: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	2
α-helix	7	1
α-helix	9-15	7
β-strand	22-28	7	2
α-helix	33-39	7
α-helix	42-48	7
β-strand	54-59	6	2
α-helix	67-70	4
β-strand	77-82	6	2
β-strand	85-91	7	2
α-helix	96-107	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thioredoxin 1	A, B	protein	108	Escherichia coli	P0AA25 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1KEB_1 Thioredoxin 1 (chains A, B)
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKLIASILDEIADEYQGKLTVAKLNI
DQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA

Ligands and cofactors

ID	Name	Formula	Copies
CU	Copper (II) ion	Cu	2

Primary citation

Structural Consequences of Replacement of an alpha-helical Pro Residue in E.coli Thioredoxin. Rudresh, Jain, R., Dani, V. et al. Protein Eng (2002) 15:627-633. DOI 10.1093/protein/15.8.627 · PubMed

Other PDB entries of the same protein (UniProt P0AA25 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HUA 1.1 Å, E. coli thioredoxin variant with (4R)-FluoroPro76 as single proline residue
5HR3 1.1 Å, Crystal structure of thioredoxin N106A mutant
5HR2 1.2 Å, Crystal structure of thioredoxin L94A mutant
5HR0 1.31 Å, Crystal structure of thioredoxin E101G mutant
4HU7 1.4 Å, E. coli thioredoxin variant with Pro76 as single proline residue
4HU9 1.55 Å, E. coli thioredoxin variant with (4S)-FluoroPro76 as single proline residue
4X43 1.65 Å, Structure of proline-free E. coli Thioredoxin
2TRX 1.68 Å, Crystal structure of thioredoxin from escherichia coli at 1.68 Å resolution
6Y4Y 1.75 Å, The crystal structure of human MACROD2 in space group P41212
2EIQ 1.9 Å, Design of Disulfide-linked Thioredoxin Dimers and Multimers Through Analysis of Crystal…
6Y4Z 1.9 Å, The crystal structure of human MACROD2 in space group P43212
6SLO 1.94 Å, Crystal structure of PUF60 UHM domain in complex with 7,8 dimethoxyperphenazine

Browse structure collections

About this viewer

MolViewer shows 1KEB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.