E. coli thioredoxin variant with (4R)-FluoroPro76 as single proline residue. Determined by X-ray diffraction at 1.1 Å resolution. Released 29 May 2013.
Explore 4HUA in 3D Show helices and sheets RCSB PDB PDBe
4HUA contains 5 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| α-helix | 12 | 1 | |
| α-helix | 13-17 | 5 | |
| β-strand | 22-28 | 7 | 1 |
| α-helix | 33-48 | 16 | |
| β-strand | 54-59 | 6 | 1 |
| α-helix | 64-69 | 6 | |
| β-strand | 77-82 | 6 | 1 |
| β-strand | 85-91 | 7 | 1 |
| α-helix | 96-105 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Thioredoxin-1 | A | protein | 108 | Escherichia coli | P0AA25 (AlphaFold model) |
>4HUA_1 Thioredoxin-1 (chains A) SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGACKMIAAILDEIADEYQGKLTVAKLNI DQNAGTAAKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
| ID | Name | Formula | Copies |
|---|---|---|---|
| CU | Copper (II) ion | Cu | 1 |
(4R)- and (4S)-Fluoroproline in the Conserved cis-Prolyl Peptide Bond of the Thioredoxin Fold: Tertiary Structure Context Dictates Ring Puckering. Rubini, M., Scharer, M.A., Capitani, G. et al. Chembiochem (2013) 14:1053-1057. DOI 10.1002/cbic.201300178 · PubMed
Other PDB entries of the same protein (UniProt P0AA25 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4HUA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.