1KGC: Immune Receptor

Immune Receptor. Determined by X-ray diffraction at 1.5 Å resolution. Released 11 Dec 2002.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,171
Mol. weight: 50.17 kDa
Released: 11 Dec 2002

Explore 1KGC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KGC contains 15 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain D: 7 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	1
β-strand	9-13	5	2
β-strand	18-24	7	1
α-helix	26-28	3
β-strand	32-37	6	2
β-strand	44-49	6	2
β-strand	55-56	2	1
β-strand	62-66	5	1
β-strand	72-77	6	1
α-helix	82-84	3
β-strand	86-91	6	2
β-strand	110-115	6	2
β-strand	124-127	4	3
α-helix	128-130	3
β-strand	137-142	6	3
α-helix	151-153	3
β-strand	159-160	2	3
α-helix	161-163	3
β-strand	164-168	5	3
α-helix	169-171	3
β-strand	173-182	10	3
α-helix	189-192	4
β-strand	203	1	3

Chain E: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	4
β-strand	10-14	5	5
β-strand	19-24	6	4
α-helix	25-26	2
β-strand	31-37	7	5
β-strand	44-50	7	5
β-strand	53-56	4	5
β-strand	65-68	4	4
β-strand	75-79	5	4
α-helix	84-86	3
β-strand	88-95	8	5
β-strand	107-108	2	5
β-strand	112-117	6	5
α-helix	120-122	3
β-strand	124	1	6
β-strand	127-131	5	7
α-helix	132-134	3
α-helix	135-141	7
β-strand	143-153	11	7
β-strand	154	1	6
β-strand	158-164	7	8
β-strand	167-169	3	8
β-strand	173-175	3	7
α-helix	179	1
β-strand	180-181	2	7
β-strand	191-200	10	7
α-helix	201-204	4
β-strand	210-217	8	8
β-strand	220	1	9
α-helix	231-232	2
β-strand	234	1	9
β-strand	236-243	8	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T-cell receptor alpha chain	D	protein	206	Homo sapiens	P01848 (AlphaFold model)
T-cell receptor beta chain	E	protein	242	Homo sapiens	P01850 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>1KGC_1 T-cell receptor alpha chain (chains D)
MKTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNNRMAS
LAIAEDRKSSTLILHRATLRDAAVYYCILPLAGGTSYGKLTFGQGTILTVHPNIQNPDPA
VYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNK
SDFACANAFNNSIIPEDTFFPSPESS

Sequence of entity 2 (E), FASTA

>1KGC_2 T-cell receptor beta chain (chains E)
MGVSQSPRYKVAKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFQNEAQLDKSGLP
SDRFFAERPEGSVSTLKIQRTQQEDSAVYLCASSLGQAYEQYFGPGTRLTVTEDLKNVFP
PEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPA
LNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGR
AD

Primary citation

The 1.5 A crystal structure of a highly selected antiviral T cell receptor provides evidence for a structural basis of immunodominance. Kjer-Nielsen, L., Clements, C.S., Brooks, A.G. et al. Structure (2002) 10:1521-1532. DOI 10.1016/S0969-2126(02)00878-X · PubMed

Other PDB entries of the same protein (UniProt P01848 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4UDT 1.35 Å, T cell receptor (TRAV22,TRBV7-9) structure
4WW1 1.38 Å, Crystal structure of human TCR Alpha Chain-TRAV21-TRAJ8 and Beta Chain-TRBV7-8
1OGA 1.4 Å, A structural basis for immunodominant human T-cell receptor recognition.
2BNU 1.4 Å, Structural and kinetic basis for heightened immunogenicity of T cell vaccines
2BNQ 1.7 Å, Structural and kinetic basis for heightened immunogenicity of T cell vaccines
2BNR 1.9 Å, Structural and kinetic basis for heightened immunogenicity of T cell vaccines
2IAL 1.92 Å, Structural basis for recognition of mutant self by a tumor-specific, MHC class…
5C0C 1.97 Å, 1E6 TCR in complex with HLA-A02 carrying RQFGPDWIVA
2VLM 1.98 Å, The Structural Dynamics and Energetics of an Immunodominant T-cell Receptor are…
5KSA 2.0 Å, Bel602-DQ8.5-glia-gamma1 complex
7RYL 2.0 Å, T cell receptor CO3
5EU6 2.02 Å, HLA Class I antigen

Browse structure collections

About this viewer

MolViewer shows 1KGC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.