1KGD: Guanylate Kinase-like Domain of Human CASK

Crystal Structure of the Guanylate Kinase-like Domain of Human CASK. Determined by X-ray diffraction at 1.31 Å resolution. Released 19 Dec 2001.

Method: X-ray diffraction
Resolution: 1.31 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,699
Mol. weight: 20.98 kDa
Released: 19 Dec 2001

Explore 1KGD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KGD contains 11 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	736-740	5	1
α-helix	747-757	11
β-strand	762-763	2	1
α-helix	766-767	2
β-strand	768-769	2	2
β-strand	779	1	3
β-strand	783	1	3
β-strand	784-785	2	2
α-helix	788-796	9
β-strand	800-806	7	2
β-strand	809-814	6	2
α-helix	815-823	9
α-helix	826	1
β-strand	827-831	5	1
α-helix	834-836	3
α-helix	837-840	4
β-strand	847-853	7	1
α-helix	854-855	2
α-helix	865-881	17
α-helix	882-884	3
β-strand	887-890	4	1
α-helix	894-908	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peripheral plasma membrane cask	A	protein	180	Homo sapiens	O14936 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1KGD_1 PERIPHERAL PLASMA MEMBRANE CASK (chains A)
GSHMRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHD
QMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFV
VFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAVELVC

Primary citation

Structural basis for nucleotide-dependent regulation of membrane-associated guanylate kinase-like domains. Li, Y., Spangenberg, O., Paarmann, I. et al. J Biol Chem (2002) 277:4159-4165. DOI 10.1074/jbc.M110792200 · PubMed

Other PDB entries of the same protein (UniProt O14936 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9M6G 1.7 Å, the crystal structure of the Ca2+/CaM-CASK-CaMK-Mint1-CID complex
9KYS 1.76 Å, the Ca2+/CaM-CASK-ARD complex
9M5Y 1.8 Å, the crystal structure of the Ca2+/CaM-CASK-CaMK complex
3C0I 1.85 Å, CASK CaM-Kinase Domain- 3'-AMP complex, P212121 form
6NH9 1.85 Å, Crystal structure of a human calcium/calmodulin dependent serine protein kinase (CASK)…
6NID 1.86 Å, Crystal structure of a human calcium/calmodulin dependent serine protein kinase (CASK)…
1KWA 1.93 Å, Human cask/lin-2 PDZ domain
7OAJ 1.93 Å, Crystal structure of pseudokinase CASK in complex with compound 7
3MFR 2.0 Å, CASK-4M CaM Kinase Domain, native
3MFS 2.1 Å, CASK-4M CaM Kinase Domain, AMPPNP
7OAL 2.17 Å, Crystal structure of pseudokinase CASK in complex with compound 25
3C0G 2.19 Å, CASK CaM-Kinase Domain- 3'-AMP complex, P1 form

Browse structure collections

About this viewer

MolViewer shows 1KGD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.