6NH9: Peripheral plasma membrane protein CASK

Crystal structure of a human calcium/calmodulin dependent serine protein kinase (CASK) PDZ domain. Determined by X-ray diffraction at 1.85 Å resolution. Released 25 Dec 2019.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,157
Mol. weight: 30.36 kDa
Released: 25 Dec 2019

Explore 6NH9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6NH9 contains 9 α-helices and 20 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	489-495	7	1
β-strand	503-507	5	1
β-strand	513-518	6	1
α-helix	523-527	5
α-helix	534	1
β-strand	535-539	5	1
β-strand	542-543	2	1
α-helix	549-558	10
β-strand	560	1	2
β-strand	561-568	8	1

Chain B: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	489-495	7	3
β-strand	503-507	5	3
β-strand	513-518	6	3
α-helix	523-527	5
α-helix	534	1
β-strand	535-539	5	3
β-strand	542-543	2	3
α-helix	549-557	9
β-strand	561-568	8	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peripheral plasma membrane protein CASK	A, B, C	protein	88	Homo sapiens	O14936 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>6NH9_1 Peripheral plasma membrane protein CASK (chains A, B, C)
MGRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISV
ANQTVEQLQKMLREMRGSITFKIVPSYR

Primary citation

CASK PDZ domain specificity. Sun, Y.J., Hou, T., Fuentes, E.J. To be published.

Other PDB entries of the same protein (UniProt O14936 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1KGD 1.31 Å, Crystal Structure of the Guanylate Kinase-like Domain of Human CASK
9M6G 1.7 Å, the crystal structure of the Ca2+/CaM-CASK-CaMK-Mint1-CID complex
9KYS 1.76 Å, the Ca2+/CaM-CASK-ARD complex
9M5Y 1.8 Å, the crystal structure of the Ca2+/CaM-CASK-CaMK complex
3C0I 1.85 Å, CASK CaM-Kinase Domain- 3'-AMP complex, P212121 form
6NID 1.86 Å, Crystal structure of a human calcium/calmodulin dependent serine protein kinase (CASK)…
1KWA 1.93 Å, Human cask/lin-2 PDZ domain
7OAJ 1.93 Å, Crystal structure of pseudokinase CASK in complex with compound 7
3MFR 2.0 Å, CASK-4M CaM Kinase Domain, native
3MFS 2.1 Å, CASK-4M CaM Kinase Domain, AMPPNP
7OAL 2.17 Å, Crystal structure of pseudokinase CASK in complex with compound 25
3C0G 2.19 Å, CASK CaM-Kinase Domain- 3'-AMP complex, P1 form

Browse structure collections

About this viewer

MolViewer shows 6NH9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.