1KWA: Human cask/lin-2 PDZ domain

Human cask/lin-2 PDZ domain. Determined by X-ray diffraction at 1.93 Å resolution. Released 27 May 1998.

Method: X-ray diffraction
Resolution: 1.93 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,571
Mol. weight: 20.68 kDa
Released: 27 May 1998

Explore 1KWA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KWA contains 7 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	489-495	7	1
β-strand	503-506	4	1
α-helix	510-512	3
β-strand	513-518	6	1
α-helix	523-527	5
α-helix	534	1
β-strand	535-539	5	1
β-strand	542-543	2	1
α-helix	544-546	3
α-helix	549-558	10
β-strand	561-568	8	1

Chain B: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	489-495	7	2
β-strand	503-506	4	2
β-strand	514-518	5	2
α-helix	523-527	5
β-strand	535-539	5	2
β-strand	542-543	2	2
α-helix	549-558	10
β-strand	561-568	8	2
β-strand	571-573	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hcask/lin-2 protein	A, B	protein	88	Homo sapiens	O14936 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1KWA_1 HCASK/LIN-2 PROTEIN (chains A, B)
RSRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVAN
QTVEQLQKMLREMRGSITFKIVPSYREF

Primary citation

Crystal structure of the hCASK PDZ domain reveals the structural basis of class II PDZ domain target recognition. Daniels, D.L., Cohen, A.R., Anderson, J.M. et al. Nat Struct Biol (1998) 5:317-325. DOI 10.1038/nsb0498-317 · PubMed

Other PDB entries of the same protein (UniProt O14936 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1KGD 1.31 Å, Crystal Structure of the Guanylate Kinase-like Domain of Human CASK
9M6G 1.7 Å, the crystal structure of the Ca2+/CaM-CASK-CaMK-Mint1-CID complex
9KYS 1.76 Å, the Ca2+/CaM-CASK-ARD complex
9M5Y 1.8 Å, the crystal structure of the Ca2+/CaM-CASK-CaMK complex
3C0I 1.85 Å, CASK CaM-Kinase Domain- 3'-AMP complex, P212121 form
6NH9 1.85 Å, Crystal structure of a human calcium/calmodulin dependent serine protein kinase (CASK)…
6NID 1.86 Å, Crystal structure of a human calcium/calmodulin dependent serine protein kinase (CASK)…
7OAJ 1.93 Å, Crystal structure of pseudokinase CASK in complex with compound 7
3MFR 2.0 Å, CASK-4M CaM Kinase Domain, native
3MFS 2.1 Å, CASK-4M CaM Kinase Domain, AMPPNP
7OAL 2.17 Å, Crystal structure of pseudokinase CASK in complex with compound 25
3C0G 2.19 Å, CASK CaM-Kinase Domain- 3'-AMP complex, P1 form

Browse structure collections

About this viewer

MolViewer shows 1KWA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.