1KJW: SH3-Guanylate Kinase Module from PSD-95

SH3-Guanylate Kinase Module from PSD-95. Determined by X-ray diffraction at 1.8 Å resolution. Released 9 Jan 2002.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Rattus norvegicus
Chains: 1
Atoms: 2,529
Mol. weight: 34.43 kDa
Released: 9 Jan 2002

Explore 1KJW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KJW contains 14 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	431-435	5	1
β-strand	439	1	2
α-helix	441-445	5
β-strand	451	1	1
β-strand	454	1	2
β-strand	459-464	6	1
β-strand	470-475	6	1
β-strand	486-489	4	1
α-helix	491-499	9
α-helix	516-518	3
β-strand	523-525	3	1
β-strand	526-530	5	3
α-helix	534-536	3
β-strand	537-540	4	4
α-helix	544-554	11
β-strand	559-560	2	5
α-helix	562-564	3
β-strand	565-566	2	6
α-helix	569-571	3
β-strand	576	1	7
β-strand	580	1	7
β-strand	581-582	2	6
α-helix	586-594	9
β-strand	598-604	7	6
β-strand	607-612	6	6
α-helix	613-621	9
β-strand	625-626	2	5
β-strand	627-628	2	4
α-helix	634-640	7
β-strand	646-650	5	4
α-helix	655-661	7
α-helix	667-684	18
α-helix	685-687	3
β-strand	690-692	3	4
α-helix	697-711	15
β-strand	715-719	5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Postsynaptic density protein 95	A	protein	295	Rattus norvegicus	P31016 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1KJW_1 POSTSYNAPTIC DENSITY PROTEIN 95 (chains A)
GFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIP
SKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRAND
DLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLY
GTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQ
ARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL

Primary citation

Structure of the SH3-Guanylate Kinase Module from PSD-95 Suggests a Mechanism for Regulated Assembly of MAGUK Scaffolding Proteins. McGee, A.W., Dakoji, S.R., Olsen, O. et al. Mol Cell (2001) 8:1291-1301. DOI 10.1016/S1097-2765(01)00411-7 · PubMed

Other PDB entries of the same protein (UniProt P31016 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5HEY 1.5 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T mutant) in complex with a…
5MZ7 1.53 Å, Crystal Structure of the third PDZ domain from the synaptic protein PSD-95 with…
1TP5 1.54 Å, Crystal structure of PDZ3 domain of PSD-95 protein complexed with a peptide ligand KKETWV
5HFD 1.6 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant)
5HFB 1.62 Å, The third PDZ domain from the synaptic protein PSD-95 (H372A mutant) in complex with a…
5HEB 1.65 Å, The third PDZ domain from the synaptic protein PSD-95 in complex with a C-terminal…
5HED 1.7 Å, The third PDZ domain from the synaptic protein PSD-95 in complex with a mutant…
5HF1 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T mutant) in complex with a…
5HFF 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant) in…
5HF4 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (H372A mutant)
5HFE 1.8 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant) in…
7CQF 1.8 Å, Crystal structure of PSD-95 PDZ3 fused with ADAM22 C-terminal peptide

Browse structure collections

About this viewer

MolViewer shows 1KJW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.