1TP5: PDZ3 domain of PSD-95 protein

Crystal structure of PDZ3 domain of PSD-95 protein complexed with a peptide ligand KKETWV. Determined by X-ray diffraction at 1.54 Å resolution. Released 20 Sept 2005.

Method: X-ray diffraction
Resolution: 1.54 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 1,106
Mol. weight: 13.53 kDa
Released: 20 Sept 2005

Explore 1TP5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1TP5 contains 6 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	302-304	3
α-helix	306-308	3
β-strand	312-317	6	1
β-strand	325-329	5	1
α-helix	331-333	3
β-strand	336-341	6	1
α-helix	346-350	5
β-strand	357-362	6	1
β-strand	365-366	2	1
α-helix	372-380	9
β-strand	385-392	8	1
α-helix	394-398	5
β-strand	404-406	3	2
β-strand	412-414	3	2

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	423-424	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Presynaptic density protein 95	A	protein	119	Rattus norvegicus	P31016 (AlphaFold model)
LYS-LYS-GLU-THR-TRP-VAL peptide ligand	B	protein	6

Sequence of entity 1 (A), FASTA

>1TP5_1 Presynaptic density protein 95 (chains A)
GSPEFLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKG
DQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVDSSGRIVTD

Sequence of entity 2 (B), FASTA

>1TP5_2 LYS-LYS-GLU-THR-TRP-VAL peptide ligand (chains B)
KKETWV

Primary citation

Structure of the third PDZ domain of PSD-95 protein complexed with KKETWV peptide ligand. Saro, D., Wawrzak, Z., Martin, P. et al. To be published.

Other PDB entries of the same protein (UniProt P31016 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5HEY 1.5 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T mutant) in complex with a…
5MZ7 1.53 Å, Crystal Structure of the third PDZ domain from the synaptic protein PSD-95 with…
5HFD 1.6 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant)
5HFB 1.62 Å, The third PDZ domain from the synaptic protein PSD-95 (H372A mutant) in complex with a…
5HEB 1.65 Å, The third PDZ domain from the synaptic protein PSD-95 in complex with a C-terminal…
5HED 1.7 Å, The third PDZ domain from the synaptic protein PSD-95 in complex with a mutant…
5HF1 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T mutant) in complex with a…
5HFF 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant) in…
5HF4 1.75 Å, The third PDZ domain from the synaptic protein PSD-95 (H372A mutant)
1KJW 1.8 Å, SH3-Guanylate Kinase Module from PSD-95
5HFE 1.8 Å, The third PDZ domain from the synaptic protein PSD-95 (G330T, H372A double mutant) in…
7CQF 1.8 Å, Crystal structure of PSD-95 PDZ3 fused with ADAM22 C-terminal peptide

Browse structure collections

About this viewer

MolViewer shows 1TP5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.