The third PDZ domain from the synaptic protein PSD-95 in complex with a mutant C-terminal peptide derived from CRIPT (T-2F). Determined by X-ray diffraction at 1.7 Å resolution. Released 16 Nov 2016.
Explore 5HED in 3D Show helices and sheets RCSB PDB PDBe
5HED contains 5 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 302-304 | 3 | |
| α-helix | 306-308 | 3 | |
| β-strand | 312-317 | 6 | 1 |
| β-strand | 325-329 | 5 | 1 |
| β-strand | 336-341 | 6 | 1 |
| α-helix | 346-350 | 5 | |
| β-strand | 357-362 | 6 | 1 |
| β-strand | 365-366 | 2 | 1 |
| α-helix | 372-380 | 9 | |
| β-strand | 385-392 | 8 | 1 |
| α-helix | 394-398 | 5 | |
| β-strand | 404-406 | 3 | 2 |
| β-strand | 412-414 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-8 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Disks large homolog 4 | A | protein | 119 | Rattus norvegicus | P31016 (AlphaFold model) |
| Cysteine-rich PDZ-binding protein | B | protein | 9 | Rattus norvegicus | Q792Q4 (AlphaFold model) |
>5HED_1 Disks large homolog 4 (chains A) GSPEFLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKG DQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVDSSGRIVTD
>5HED_2 Cysteine-rich PDZ-binding protein (chains B) TKNYKQFSV
Origins of Allostery and Evolvability in Proteins: A Case Study. Raman, A.S., White, K.I., Ranganathan, R. Cell (2016) 166:468-480. DOI 10.1016/j.cell.2016.05.047 · PubMed
Other PDB entries of the same protein (UniProt P31016 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5HED directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.