1KKX: DNA-binding domain of ADR6

Solution structure of the DNA-binding domain of ADR6. Determined by solution NMR. Released 17 Jul 2002.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 860
Mol. weight: 14.57 kDa
Released: 17 Jul 2002

Explore 1KKX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KKX contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	6-20	15
α-helix	40-45	6
α-helix	51-54	4
α-helix	58-67	10
α-helix	72-76	5
α-helix	77-82	6
α-helix	83-89	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription regulatory protein ADR6	A	protein	123	Saccharomyces cerevisiae	P09547 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1KKX_1 Transcription regulatory protein ADR6 (chains A)
MRGSGSHHHHHHGSNNKQYELFMKSLIENCKKRNMPLQSIPEIGNRKINLFYLYMLVQKF
GGADQVTRTQQWSMVAQRLQISDYQQLESIYFRILLPYERHMISQEGIKETQAKRILQPS
LIS

Primary citation

1H, 13C and 15N resonance assignments and secondary structure of ADR6 DNA-binding domain. Tu, X., Wu, J., Xu, Y. et al. J Biomol NMR (2001) 21:187-188. DOI 10.1023/A:1012434510376 · PubMed

Other PDB entries of the same protein (UniProt P09547 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7C4J 2.89 Å, Cryo-EM structure of the yeast Swi/Snf complex in a nucleosome free state
7EGM 3.6 Å, The SRM module of SWI/SNF-nucleosome complex
6UXV 4.7 Å, SWI/SNF Body Module
7EGP 6.9 Å, The structure of SWI/SNF-nucleosome complex
6UXW 8.96 Å, SWI/SNF nucleosome complex with ADP-BeFx
1KN5 Solution structure of arid domain of ADR6 from saccharomyces cerevisiae
2LI6 1H, 13C, and 15N Chemical Shift Assignments for yeast protein

Browse structure collections

About this viewer

MolViewer shows 1KKX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.