2LI6: PDB entry 2LI6

1H, 13C, and 15N Chemical Shift Assignments for yeast protein. Determined by solution NMR. Released 25 Apr 2012.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 968
Mol. weight: 13.82 kDa
Released: 25 Apr 2012

Explore 2LI6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LI6 contains 7 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	9	1	1
α-helix	17-32	16
β-strand	45	1	1
α-helix	53-61	9
α-helix	64-69	6
α-helix	73-80	8
α-helix	87-96	10
α-helix	98-105	8
α-helix	110-114	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SWI/SNF chromatin-remodeling complex subunit SWI1	A	protein	116	Saccharomyces cerevisiae	P09547 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LI6_1 SWI/SNF chromatin-remodeling complex subunit SWI1 (chains A)
QSLNPALQEKISTELNNKQYELFMKSLIENCKKRNMPLQSIPEIGNRKINLFYLYMLVQK
FGGADQVTRTQQWSMVAQRLQISDYQQLESIYFRILLPYERHMISQEGIKETQAKR

Primary citation

Solution structure of SWI1 ARID domain from Saccharomyces cerevisiae and its non-specific binding to DNA. Wang, T., Zhang, J., Zhang, X. et al. Proteins (2012). DOI 10.1002/prot.24091 · PubMed

Other PDB entries of the same protein (UniProt P09547 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7C4J 2.89 Å, Cryo-EM structure of the yeast Swi/Snf complex in a nucleosome free state
7EGM 3.6 Å, The SRM module of SWI/SNF-nucleosome complex
6UXV 4.7 Å, SWI/SNF Body Module
7EGP 6.9 Å, The structure of SWI/SNF-nucleosome complex
6UXW 8.96 Å, SWI/SNF nucleosome complex with ADP-BeFx
1KKX Solution structure of the DNA-binding domain of ADR6
1KN5 Solution structure of arid domain of ADR6 from saccharomyces cerevisiae

Browse structure collections

About this viewer

MolViewer shows 2LI6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.