1KL9: PDB entry 1KL9

Name: PDB 1KL9: Crystal structure of the N-terminal segment of Human eukaryotic initiation factor 2alpha
Published: 2002-03-11
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: translation

Crystal structure of the N-terminal segment of Human eukaryotic initiation factor 2alpha. Determined by X-ray diffraction at 1.9 Å resolution. Released 11 Mar 2002.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,400
Mol. weight: 21.7 kDa
Ligands: ZN
Released: 11 Mar 2002

Explore 1KL9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KL9 contains 8 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	13-14	2
β-strand	18-26	9	1
β-strand	30-35	6	1
β-strand	41-46	6	1
α-helix	47-49	3
β-strand	67-76	10	1
β-strand	81-85	5	1
α-helix	91-117	27
α-helix	123-132	10
α-helix	134-141	8
α-helix	146-157	12
α-helix	159-162	4
α-helix	169-181	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic translation initiation factor 2 subunit 1	A	protein	182	Homo sapiens	P05198 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1KL9_1 EUKARYOTIC TRANSLATION INITIATION FACTOR 2 SUBUNIT 1 (chains A)
PGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSINK
LIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLEY
TKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNIN
RR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Crystal structure of the N-terminal segment of human eukaryotic translation initiation factor 2alpha. Nonato, M.C., Widom, J., Clardy, J. J Biol Chem (2002) 277:17057-17061. DOI 10.1074/jbc.M111804200 · PubMed

Other PDB entries of the same protein (UniProt P05198 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8PPL 2.65 Å, MERS-CoV Nsp1 bound to the human 43S pre-initiation complex
9HVE 2.7 Å, Native human eIF2-eIF2B complex
7F66 2.76 Å, eIF2B-SFSV NSs-1-eIF2
28ZX 2.8 Å, human 48S PIC with mRNA (Kozak_1)
9QC6 2.83 Å, Structure of eIF2B decamer bound to (P)eIF2 alpha and Compound A-(S)
28ZV 2.9 Å, human 48S PIC with mRNA (non-Kozak)
6ZP4 2.9 Å, SARS-CoV-2 Nsp1 bound to a human 43S preinitiation ribosome complex - state 2
28ZY 3.0 Å, human 48S PIC with mRNA (Kozak_2)
9Y5R 3.01 Å, Eukaryotic translation initiation factor 2-B (eIF2B) bound to phosphorylated eIF2alpha…
6O85 3.03 Å, Electron cryo-microscopy of the eukaryotic translation initiation factor 2B bound to…
6O9Z 3.03 Å, Electron cryo-microscopy of the eukaryotic translation initiation factor 2B bound to…
9NB9 3.03 Å, Viral protein DP71L in complex with phosphorylated eIF2alpha (NTD) and protein…

Browse structure collections

About this viewer

MolViewer shows 1KL9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.