1KLO: Laminin

Crystal structure of three consecutive laminin-type epidermal growth factor-like (LE) modules of laminin GAMMA1 chain harboring the nidogen binding site. Determined by X-ray diffraction at 2.1 Å resolution. Released 20 Aug 1997.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Mus musculus
Chains: 1
Atoms: 1,298
Mol. weight: 17.14 kDa
Released: 20 Aug 1997

Explore 1KLO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KLO contains 7 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	19-21	3	1
β-strand	28-30	3	1
α-helix	33-34	2
β-strand	37-38	2	2
β-strand	44-45	2	2
α-helix	46	1
β-strand	49-52	4	3
β-strand	61-65	5	3
β-strand	72	1	4
β-strand	80	1	5
β-strand	87	1	5
β-strand	90	1	4
β-strand	94-95	2	6
β-strand	101-102	2	6
β-strand	106-108	3	7
α-helix	115-117	3
β-strand	119-121	3	7
β-strand	129	1	8
α-helix	130-132	3
β-strand	145	1	8
α-helix	146	1
β-strand	149-150	2	9
β-strand	156-157	2	9
α-helix	158	1
β-strand	162	1	10
α-helix	164-166	3
β-strand	171	1	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Laminin	A	protein	162	Mus musculus	P02468 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1KLO_1 LAMININ (chains A)
CPCPGGSSCAIVPKTKEVVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCND
NIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACACNPYGTV
QQQSSCNPVTGQCQCLPHVSGRDCGTCDPGYYNLQSGQGCER

Primary citation

Crystal structure of three consecutive laminin-type epidermal growth factor-like (LE) modules of laminin gamma1 chain harboring the nidogen binding site. Stetefeld, J., Mayer, U., Timpl, R. et al. J Mol Biol (1996) 257:644-657. DOI 10.1006/jmbi.1996.0191 · PubMed

Other PDB entries of the same protein (UniProt P02468 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MC9 2.13 Å, Crystal structure of the heterotrimeric integrin-binding region of laminin-111
1NPE 2.3 Å, Crystal structure of Nidogen/Laminin Complex
4AQT 3.2 Å, Laminin gamma1 LN-LE1-2 structure
1TLE Le (laminin-type egf-like) module GIII4 in solution at PH 3.5 and 290 K, NMR, 14…

Browse structure collections

About this viewer

MolViewer shows 1KLO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.