4AQT: Laminin gamma1 LN-LE1-2 structure

Laminin gamma1 LN-LE1-2 structure. Determined by X-ray diffraction at 3.2 Å resolution. Released 15 Aug 2012.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: MUS MUSCULUS
Chains: 1
Atoms: 2,742
Mol. weight: 42.82 kDa
Ligands: NAG, CA
Released: 15 Aug 2012

Explore 4AQT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4AQT contains 16 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	39	1	1
β-strand	45	1	1
α-helix	50-52	3
β-strand	53-54	2	2
β-strand	62-63	2	2
β-strand	72-75	4	3
β-strand	87-90	4	3
α-helix	101-104	4
β-strand	116-117	2	2
α-helix	118-120	3
α-helix	121-123	3
β-strand	131-150	20	2
α-helix	154-155	2
β-strand	157-163	7	2
β-strand	171-177	7	2
α-helix	180-184	5
α-helix	192-193	2
β-strand	202-204	3	2
β-strand	216-221	6	2
α-helix	229-234	6
α-helix	236-241	6
β-strand	243-253	11	2
α-helix	259-261	3
α-helix	265-268	4
β-strand	274-284	11	2
β-strand	293-295	3	4
β-strand	301-303	3	4
β-strand	309-310	2	5
β-strand	316-317	2	5
α-helix	318	1
α-helix	337-340	4
α-helix	342-344	3
β-strand	349-351	3	6
α-helix	353-358	6
β-strand	363-365	3	6
β-strand	372-373	2	7
β-strand	379-380	2	7
β-strand	384-385	2	8
α-helix	393	1
β-strand	394-395	2	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Laminin subunit gamma-1	A	protein	375	MUS MUSCULUS	P02468 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4AQT_1 LAMININ SUBUNIT GAMMA-1 (chains A)
APLAAMDECADEGGRPQRCMPEFVNAAFNVTVVATNTCGTPPEEYCVQTGVTGVTKSCHL
CDAGQQHLQHGAAFLTDYNNQADTTWWQSQTMLAGVQYPNSINLTLHLGKAFDITYVRLK
FHTSRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGFIRTGGDEQQALCTDEFSD
ISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLNTFGDEVFNEPKVLK
SYYYAISDFAVGGRCKCNGHASECVKNEFDKLMCNCKHNTYGVDCEKCLPFFNDRPWRRA
TAESASECLPCDCNGRSQECYFDPELYRSTGHGGHCTNCRDNTDGAKCERCRENFFRLGN
TEACSPAAAHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1
CA	Calcium ion	Ca	1

Primary citation

Crystal Structures of the Network-Forming Short-Arm Tips of the Laminin Beta1 and Gamma1 Chains. Carafoli, F., Hussain, S., Hohenester, E. PLoS One (2012) 7:42473. DOI 10.1371/JOURNAL.PONE.0042473 · PubMed

Other PDB entries of the same protein (UniProt P02468 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1KLO 2.1 Å, Crystal structure of three consecutive laminin-type epidermal growth factor-like (LE)…
5MC9 2.13 Å, Crystal structure of the heterotrimeric integrin-binding region of laminin-111
1NPE 2.3 Å, Crystal structure of Nidogen/Laminin Complex
1TLE Le (laminin-type egf-like) module GIII4 in solution at PH 3.5 and 290 K, NMR, 14…

Browse structure collections

About this viewer

MolViewer shows 4AQT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.