Crystal structure of three consecutive laminin-type epidermal growth factor-like (LE) modules of laminin GAMMA1 chain harboring the nidogen binding site. Determined by X-ray diffraction at 2.1 Å resolution. Released 20 Aug 1997.
Explore 1KLO in 3D Show helices and sheets RCSB PDB PDBe
1KLO contains 7 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 19-21 | 3 | 1 |
| β-strand | 28-30 | 3 | 1 |
| α-helix | 33-34 | 2 | |
| β-strand | 37-38 | 2 | 2 |
| β-strand | 44-45 | 2 | 2 |
| α-helix | 46 | 1 | |
| β-strand | 49-52 | 4 | 3 |
| β-strand | 61-65 | 5 | 3 |
| β-strand | 72 | 1 | 4 |
| β-strand | 80 | 1 | 5 |
| β-strand | 87 | 1 | 5 |
| β-strand | 90 | 1 | 4 |
| β-strand | 94-95 | 2 | 6 |
| β-strand | 101-102 | 2 | 6 |
| β-strand | 106-108 | 3 | 7 |
| α-helix | 115-117 | 3 | |
| β-strand | 119-121 | 3 | 7 |
| β-strand | 129 | 1 | 8 |
| α-helix | 130-132 | 3 | |
| β-strand | 145 | 1 | 8 |
| α-helix | 146 | 1 | |
| β-strand | 149-150 | 2 | 9 |
| β-strand | 156-157 | 2 | 9 |
| α-helix | 158 | 1 | |
| β-strand | 162 | 1 | 10 |
| α-helix | 164-166 | 3 | |
| β-strand | 171 | 1 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Laminin | A | protein | 162 | Mus musculus | P02468 (AlphaFold model) |
>1KLO_1 LAMININ (chains A) CPCPGGSSCAIVPKTKEVVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCND NIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACACNPYGTV QQQSSCNPVTGQCQCLPHVSGRDCGTCDPGYYNLQSGQGCER
Crystal structure of three consecutive laminin-type epidermal growth factor-like (LE) modules of laminin gamma1 chain harboring the nidogen binding site. Stetefeld, J., Mayer, U., Timpl, R. et al. J Mol Biol (1996) 257:644-657. DOI 10.1006/jmbi.1996.0191 · PubMed
Other PDB entries of the same protein (UniProt P02468 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1KLO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.