1KO9: 8-oxoguanine DNA glycosylase

Native Structure of the Human 8-oxoguanine DNA Glycosylase hOGG1. Determined by X-ray diffraction at 2.15 Å resolution. Released 9 Jan 2002.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,599
Mol. weight: 39.03 kDa
Released: 9 Jan 2002

Explore 1KO9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KO9 contains 20 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	20-22	3
β-strand	24-27	4	1
α-helix	35-38	4
β-strand	47-51	5	1
β-strand	54-58	5	1
β-strand	63-68	6	1
β-strand	72-77	6	1
α-helix	87-89	3
α-helix	90-99	10
α-helix	106-116	11
α-helix	118-126	9
α-helix	137-145	9
α-helix	152-166	15
α-helix	168	1
β-strand	169-173	5	2
β-strand	176-179	4	2
α-helix	181-183	3
α-helix	184-188	5
α-helix	192-199	8
α-helix	205-213	9
α-helix	214-218	5
α-helix	222-228	7
α-helix	233-240	8
α-helix	248-257	10
α-helix	269-279	11
α-helix	293-307	15
α-helix	311-322	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
8-oxoguanine DNA glycosylase	A	protein	345	Homo sapiens	O15527 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1KO9_1 8-oxoguanine DNA glycosylase (chains A)
MPARALLPRRMGHRTLASTPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLA
DQVWTLTQTEEQLHCTVYRGDKSQASRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHF
QEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHG
FPSLQALAGPEVEAHLRKLGLGYRARYVSASARAILEEQGGLAWLQQLRESSYEEAHKAL
CILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELG
NFFRSLWGPYAGWAQAVLFSADLRQSRHAQEPPAKRRKGSKGPEG

Primary citation

Reciprocal "flipping" underlies substrate recognition and catalytic activation by the human 8-oxo-guanine DNA glycosylase. Bjoras, M., Seeberg, E., Luna, L. et al. J Mol Biol (2002) 317:171-177. DOI 10.1006/jmbi.2002.5400 · PubMed

Other PDB entries of the same protein (UniProt O15527 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8XWC 1.45 Å, Crystal structure of human 8-oxoguanine glycosylase K249H mutant bound to the substrate…
2XHI 1.55 Å, Separation-of-function mutants unravel the dual reaction mode of human 8-oxoguanine DNA…
5AN4 1.6 Å, Crystal structure of the human 8-oxoguanine glycosylase (OGG1) processed with the…
8XWU 1.68 Å, Crystal structure of human 8-oxoguanine glycosylase K249H mutant bound to the reaction…
8XXK 1.7 Å, Crystal structure of human 8-oxoguanine glycosylase K249H mutant bound to the reaction…
8XXG 1.82 Å, Crystal structure of human 8-oxoguanine glycosylase K249H mutant bound to the reaction…
9NZ8 1.85 Å, Crystal structure of human OGG1 in a DNA-free state
1M3Q 1.9 Å, Crystal Structure of hogg1 D268E Mutant with Base-Excised DNA and 8-aminoguanine
6RLW 2.0 Å, Structure of the human 8-oxoguanine DNA Glycosylase hOGG1 in complex with inhibitor TH5487
7AYY 2.0 Å, Structure of the human 8-oxoguanine DNA Glycosylase hOGG1 in complex with activator…
9NZ9 2.0 Å, Crystal structure of product-bound human OGG1(WT)
1LWY 2.01 Å, hOgg1 Borohydride-Trapped Intermediate without 8-oxoguanine

Browse structure collections

About this viewer

MolViewer shows 1KO9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.