1KOO: Tip associating protein

The crystal structure and mutational analysis of a novel RNA-binding domain found in the human tap nuclear mRNA export factor. Determined by X-ray diffraction at 3.8 Å resolution. Released 27 Feb 2002.

Method: X-ray diffraction
Resolution: 3.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,832
Mol. weight: 126.06 kDa
Released: 27 Feb 2002

Explore 1KOO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KOO contains 31 α-helices and 38 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	119-125	7	1
α-helix	127-129	3
α-helix	132-142	11
β-strand	153-155	3	1
β-strand	158-163	6	1
α-helix	166-170	5
β-strand	179-180	2	2
β-strand	186-187	2	2
β-strand	190-194	5	1
α-helix	206-218	13
β-strand	228	1	3
α-helix	251-262	12
β-strand	269	1	4
β-strand	271	1	3
α-helix	286-289	4
β-strand	295	1	4
α-helix	309-312	4
β-strand	319-320	2	4
α-helix	326-328	3
α-helix	337-344	8
β-strand	350-351	2	4

Chain B: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	208-216	9
β-strand	226-228	3	5
α-helix	236-240	5
α-helix	253-260	8
β-strand	269-271	3	5
α-helix	286-289	4
β-strand	295-297	3	5
α-helix	306-308	3
β-strand	319-321	3	5
α-helix	334-340	7
β-strand	350-351	2	5
α-helix	356-358	3

Chain C: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	121-125	5	6
α-helix	134-140	7
β-strand	151	1	6
β-strand	155	1	6
β-strand	158-162	5	6
α-helix	166-168	3
β-strand	181	1	7
β-strand	185	1	7
β-strand	190-192	3	6
α-helix	208-217	10
β-strand	220-221	2	8
β-strand	226-227	2	8
α-helix	236-238	3
α-helix	250-263	14
β-strand	269-271	3	9
α-helix	286-288	3
β-strand	295-297	3	9
β-strand	319-321	3	9
α-helix	327-330	4
α-helix	337-340	4
β-strand	350-351	2	9
β-strand	355	1	9

Chain D: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	206-219	14
β-strand	220-221	2	10
β-strand	226-228	3	10
α-helix	250-263	14
β-strand	269-271	3	10
α-helix	281-286	6
β-strand	295-297	3	10
α-helix	308-312	5
β-strand	319-321	3	10
α-helix	336-339	4
α-helix	341-344	4
β-strand	350-351	2	10
β-strand	355	1	10
α-helix	356-357	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tip associating protein	A, B, C, D	protein	277	Homo sapiens	Q9UBU9 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1KOO_1 TIP ASSOCIATING PROTEIN (chains A, B, C, D)
VRRDRAPPERGGAGTSQDGTSKNWFKITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYE
NTRAQFFVEDASTASALKAVNYKILDRENRRISIIINSSAPPHTILNELKPEQVEQLKLI
MSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSSMAATLRIIEENIPELLSLNLSNN
RLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQS
TYISAIRERFPKLLRLDGHELPPPIAFDVEAPTTLPP

Primary citation

The crystal structure and mutational analysis of a novel RNA-binding domain found in the human Tap nuclear mRNA export factor. Ho, D.N., Coburn, G.A., Kang, Y. et al. Proc Natl Acad Sci U S A (2002) 99:1888-1893. DOI 10.1073/pnas.042698599 · PubMed

Other PDB entries of the same protein (UniProt Q9UBU9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1OAI 1.0 Å, Complex between Tap UBA domain and FxFG nucleoporin peptide
9I8A 1.5 Å, NXT1-NXF1 complex crystallized in space group P65 2 2
1JKG 1.9 Å, Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain…
3RW6 2.3 Å, Structure of nuclear RNA export factor TAP bound to CTE RNA
2Z5K 2.6 Å, Complex of Transportin 1 with TAP NLS
1JN5 2.8 Å, Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain…
1FO1 2.9 Å, Crystal structure of the RNA-binding domain of the mRNA export factor tap
2Z5M 3.0 Å, Complex of Transportin 1 with TAP NLS, crystal form 2
3RW7 3.0 Å, Structure of N-terminal domain of nuclear RNA export factor TAP
1FT8 3.15 Å, Crystal structure of the RNA-binding domain of the mRNA export factor tap
4WYK 3.4 Å, Structure of the LRR and NTF2-like domains of NXF1 complexed with NXT1
1KOH 3.8 Å, The crystal structure and mutational analysis of a novel RNA-binding domain found in the…

Browse structure collections

About this viewer

MolViewer shows 1KOO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.