1KS0: Matrix Metalloproteinase 2

The First Fibronectin Type II Module from Human Matrix Metalloproteinase 2. Determined by solution NMR. Released 20 Feb 2002.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 477
Mol. weight: 7.28 kDa
Released: 20 Feb 2002

Explore 1KS0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KS0 contains 1 α-helix and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	1
β-strand	18-20	3	2
β-strand	23-25	3	2
β-strand	29	1	1
β-strand	39-41	3	1
β-strand	45	1	2
α-helix	46-49	4
β-strand	52-54	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Matrix Metalloproteinase 2	A	protein	63	Homo sapiens	P08253 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1KS0_1 Matrix Metalloproteinase 2 (chains A)
RIPVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEAL
FTM

Primary citation

The col-1 module of human matrix metalloproteinase-2 (MMP-2): structural/functional relatedness between gelatin-binding fibronectin type II modules and lysine-binding kringle domains. Gehrmann, M., Briknarova, K., Banyai, L. et al. Biol Chem (2002) 383:137-148. DOI 10.1515/BC.2002.014 · PubMed

Other PDB entries of the same protein (UniProt P08253 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AYU 2.0 Å, Crystal structure of MMP-2 active site mutant in complex with APP-drived decapeptide…
7XJO 2.0 Å, Crystal structure of human MMP-2 catalytic domain in complex with inhibitor
1GEN 2.15 Å, C-terminal domain of gelatinase a
8H78 2.4 Å, Crystal structure of human MMP-2 catalytic domain in complex with inhibitor
1RTG 2.6 Å, C-terminal domain (haemopexin-like domain) of human matrix metalloproteinase-2
1EAK 2.66 Å, Catalytic domain of proMMP-2 E404Q mutant
1CK7 2.8 Å, Gelatinase a (full-length)
1QIB 2.8 Å, Crystal structure of gelatinase a catalytic domain
7XGJ 2.8 Å, Crystal structure of human MMP-2 catalytic domain in complex with inhibitor
1GXD 3.1 Å, proMMP-2/TIMP-2 complex
1CXW The second type II module from human matrix metalloproteinase 2
1HOV Solution structure of a catalytic domain of mmp-2 complexed with sc-74020

Browse structure collections

About this viewer

MolViewer shows 1KS0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.