1KSH: Complex of Arl2 and PDE delta, Crystal Form 2

Complex of Arl2 and PDE delta, Crystal Form 2 (native). Determined by X-ray diffraction at 1.8 Å resolution. Released 8 May 2002.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 2,694
Mol. weight: 39.33 kDa
Ligands: MG, PO4, GDP
Released: 8 May 2002

Explore 1KSH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KSH contains 12 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	17-22	6	1
α-helix	29-36	8
β-strand	50-57	8	1
β-strand	60-67	8	1
α-helix	71-74	4
α-helix	77-80	4
β-strand	86-92	7	1
α-helix	96-98	3
α-helix	99-110	12
α-helix	113-115	3
β-strand	119-125	7	1
α-helix	132-134	3
α-helix	135-141	7
α-helix	144-146	3
β-strand	152-156	5	1
α-helix	165-177	13

Chain B: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
β-strand	15-24	10	1
β-strand	29-34	6	1
β-strand	46-49	4	2
α-helix	51-55	5
β-strand	59-67	9	1
β-strand	71-82	12	2
β-strand	85-97	13	2
β-strand	101-109	9	1
β-strand	127-135	9	2
β-strand	138-149	12	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
arf-like protein 2	A	protein	186	Mus musculus	Q9D0J4 (AlphaFold model)
Retinal rod rhodopsin-sensitive cgmp 3',5'-cyclic phosphodiesterase delta-subunit	B	protein	152	Homo sapiens	O43924 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1KSH_1 arf-like protein 2 (chains A)
GSMGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDVDTISPTLGFNIKTLEHR
GFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGA
TLLIFANKQDLPGALSCNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWLLDDISS
RVFTAD

Sequence of entity 2 (B), FASTA

>1KSH_2 RETINAL ROD RHODOPSIN-SENSITIVE CGMP 3',5'-CYCLIC PHOSPHODIESTERASE DELTA-SUBUNIT (chains B)
GSMSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKA
VSRELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMM
PASVLTGNVIIETKFFDDDLLVSTSRVRLFYV

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
PO4	Phosphate ion	O4 P	1
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1

Primary citation

The complex of Arl2-GTP and PDE delta: from structure to function. Hanzal-Bayer, M., Renault, L., Roversi, P. et al. EMBO J (2002) 21:2095-2106. DOI 10.1093/emboj/21.9.2095 · PubMed

Other PDB entries of the same protein (UniProt Q9D0J4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1KSG 2.3 Å, Complex of Arl2 and PDE delta, Crystal Form 1
1KSJ 2.6 Å, Complex of Arl2 and PDE delta, Crystal Form 2 (SeMet)
4GOK 2.6 Å, The Crystal structure of Arl2GppNHp in complex with UNC119a

Browse structure collections

About this viewer

MolViewer shows 1KSH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.