1LB4: TRAF6 apo structure

TRAF6 apo structure. Determined by X-ray diffraction at 2.4 Å resolution. Released 31 Jul 2002.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,314
Mol. weight: 18.55 kDa
Released: 31 Jul 2002

Explore 1LB4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LB4 contains 6 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	352-357	6	1
α-helix	360-368	9
β-strand	373-376	4	2
α-helix	377-379	3
β-strand	380-381	2	2
β-strand	388-395	8	2
β-strand	406-413	8	2
α-helix	419-421	3
β-strand	428-434	7	1
α-helix	440-442	3
β-strand	446-451	6	1
α-helix	461-462	2
β-strand	471-478	8	2
α-helix	479-484	6
β-strand	489	1	3
β-strand	492	1	3
β-strand	493-501	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TNF receptor-associated factor 6	A	protein	159	Homo sapiens	Q9Y4K3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1LB4_1 TNF receptor-associated factor 6 (chains A)
QCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYI
SLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRN
PKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDLE

Primary citation

Distinct molecular mechanism for initiating TRAF6 signalling. Ye, H., Arron, J.R., Lamothe, B. et al. Nature (2002) 418:443-447. DOI 10.1038/nature00888 · PubMed

Other PDB entries of the same protein (UniProt Q9Y4K3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LB6 1.8 Å, TRAF6-CD40 Complex
3HCT 2.1 Å, Crystal structure of TRAF6 in complex with Ubc13 in the P1 space group
6A33 2.1 Å, Binding and Enhanced Binding between Key Immunity Proteins TRAF6 and TIFA
3HCS 2.2 Å, Crystal structure of the N-terminal domain of TRAF6
1LB5 2.4 Å, TRAF6-RANK Complex
3HCU 2.6 Å, Crystal structure of TRAF6 in complex with Ubc13 in the C2 space group
5ZUJ 2.6 Å, Binding and Enhanced Binding between Key Immunity Proteins TRAF6 and TIFA
8HZ2 2.6 Å, Tumor Necrosis Factor Receptor Associated Factor 6 (TRAF6) N-terminal Domain
7L3L 2.8 Å, Structure of TRAF5 and TRAF6 RING Hetero dimer
4Z8M 2.95 Å, Crystal structure of the MAVS-TRAF6 complex
2ECI Solution structure of the RING domain of the human TNF receptor-associated factor 6…
2JMD Solution Structure of the Ring Domain of Human TRAF6

Browse structure collections

About this viewer

MolViewer shows 1LB4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.