1LCC: Lac Repressor

Structure of the complex of lac repressor headpiece and an 11 base-pair half-operator determined by nuclear magnetic resonance spectroscopy and restrained molecular dynamics. Determined by solution NMR. Released 31 Jan 1994.

Method: Solution NMR
Organism: Escherichia coli
Chains: 3
Atoms: 898
Mol. weight: 12.42 kDa
Released: 31 Jan 1994

Explore 1LCC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LCC contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	6-13	8
α-helix	17-24	8
α-helix	32-44	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(apaptptpgptpgpapgpcp*g)-3')	B	DNA	11
DNA (5'-d(cpgpcptpcpapcpapaptp*t)-3')	C	DNA	11
Lac Repressor	A	protein	51	Escherichia coli	P03023 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>1LCC_1 DNA (5'-D(*AP*AP*TP*TP*GP*TP*GP*AP*GP*CP*G)-3') (chains B)
AATTGTGAGCG

Sequence of entity 2 (C), FASTA

>1LCC_2 DNA (5'-D(*CP*GP*CP*TP*CP*AP*CP*AP*AP*TP*T)-3') (chains C)
CGCTCACAATT

Sequence of entity 3 (A), FASTA

>1LCC_3 Lac Repressor (chains A)
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNR

Primary citation

Other PDB entries of the same protein (UniProt P03023 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8GOH 1.1 Å, Homotetramic Antiparallel Coiled-Coil of 23-residues LacI C-terminal tetramerization helix
1JYE 1.7 Å, Structure of a Dimeric Lac Repressor with C-terminal Deletion and K84L Substitution
2P9H 2.0 Å, High resolution structure of the Lactose Repressor bound to IPTG
3EDC 2.1 Å, Crystal Structure of a 1.6-hexanediol Bound Tetrameric Form of Escherichia coli…
1EFA 2.6 Å, Crystal structure of the lac repressor dimer bound to operator and the anti-inducer onpf
1TLF 2.6 Å, Unprecedented quaternary structure of E. Coli lac repressor core tetramer: implications…
1LBI 2.7 Å, Lac repressor
4RZS 2.71 Å, Lac repressor engineered to bind sucralose, unliganded tetramer
1JYF 3.0 Å, Structure of the Dimeric Lac Repressor with an 11-residue C-terminal Deletion.
4RZT 3.1 Å, Lac repressor engineered to bind sucralose, sucralose-bound tetramer
1LBH 3.2 Å, Intact lactose operon repressor with gratuitous inducer iptg
2PAF 3.5 Å, Crystal Structure of the Lactose Repressor bound to anti-inducer ONPF in induced state

Browse structure collections

About this viewer

MolViewer shows 1LCC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.