Structure of the complex of lac repressor headpiece and an 11 base-pair half-operator determined by nuclear magnetic resonance spectroscopy and restrained molecular dynamics. Determined by solution NMR. Released 31 Jan 1994.
Explore 1LCD in 3D Show helices and sheets RCSB PDB PDBe
1LCD contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-13 | 8 | |
| α-helix | 17-24 | 8 | |
| α-helix | 32-44 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA (5'-d(*ap*ap*tp*tp*gp*tp*gp*ap*gp*cp*g)-3') | B | DNA | 11 | ||
| DNA (5'-d(*cp*gp*cp*tp*cp*ap*cp*ap*ap*tp*t)-3') | C | DNA | 11 | ||
| Lac Repressor | A | protein | 51 | Escherichia coli | P03023 (AlphaFold model) |
>1LCD_1 DNA (5'-D(*AP*AP*TP*TP*GP*TP*GP*AP*GP*CP*G)-3') (chains B) AATTGTGAGCG
>1LCD_2 DNA (5'-D(*CP*GP*CP*TP*CP*AP*CP*AP*AP*TP*T)-3') (chains C) CGCTCACAATT
>1LCD_3 Lac Repressor (chains A) MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNR
Structure of the complex of lac repressor headpiece and an 11 base-pair half-operator determined by nuclear magnetic resonance spectroscopy and restrained molecular dynamics. Chuprina, V.P., Rullmann, J.A., Lamerichs, R.M. et al. J Mol Biol (1993) 234:446-462. DOI 10.1006/jmbi.1993.1598 · PubMed
Other PDB entries of the same protein (UniProt P03023 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1LCD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.