Structural basis for altered function in the common mutants of human apolipoprotein-E. Determined by X-ray diffraction at 2.5 Å resolution. Released 15 Oct 1992.
Explore 1LE4 in 3D Show helices and sheets RCSB PDB PDBe
1LE4 contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 25-42 | 18 | |
| α-helix | 45-50 | 6 | |
| α-helix | 55-78 | 24 | |
| α-helix | 89-125 | 37 | |
| α-helix | 131-160 | 30 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Apolipoprotein E4 | A | protein | 144 | Homo sapiens | P02649 (AlphaFold model) |
>1LE4_1 APOLIPOPROTEIN E4 (chains A) GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQL TPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLR KLRKRLLRDADDLQKRLAVYQAGA
Human apolipoprotein E. Role of arginine 61 in mediating the lipoprotein preferences of the E3 and E4 isoforms. Dong, L.M., Wilson, C., Wardell, M.R. et al. J Biol Chem (1994) 269:22358-22365. PubMed
Other PDB entries of the same protein (UniProt P02649 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1LE4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.