1LQC: Lac repressor

Lac repressor headpiece (residues 1-56), NMR, 32 structures. Determined by solution NMR. Released 12 Feb 1997.

Method: Solution NMR
Organism: Escherichia coli
Chains: 1
Atoms: 435
Mol. weight: 6.23 kDa
Released: 12 Feb 1997

Explore 1LQC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LQC contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	7-12	6
α-helix	17-24	8
α-helix	32-44	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lac repressor	A	protein	56	Escherichia coli	P03023 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1LQC_1 LAC REPRESSOR (chains A)
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQL

Primary citation

Refined structure of lac repressor headpiece (1-56) determined by relaxation matrix calculations from 2D and 3D NOE data: change of tertiary structure upon binding to the lac operator. Slijper, M., Bonvin, A.M., Boelens, R. et al. J Mol Biol (1996) 259:761-773. DOI 10.1006/jmbi.1996.0356 · PubMed

Other PDB entries of the same protein (UniProt P03023 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8GOH 1.1 Å, Homotetramic Antiparallel Coiled-Coil of 23-residues LacI C-terminal tetramerization helix
1JYE 1.7 Å, Structure of a Dimeric Lac Repressor with C-terminal Deletion and K84L Substitution
2P9H 2.0 Å, High resolution structure of the Lactose Repressor bound to IPTG
3EDC 2.1 Å, Crystal Structure of a 1.6-hexanediol Bound Tetrameric Form of Escherichia coli…
1EFA 2.6 Å, Crystal structure of the lac repressor dimer bound to operator and the anti-inducer onpf
1TLF 2.6 Å, Unprecedented quaternary structure of E. Coli lac repressor core tetramer: implications…
1LBI 2.7 Å, Lac repressor
4RZS 2.71 Å, Lac repressor engineered to bind sucralose, unliganded tetramer
1JYF 3.0 Å, Structure of the Dimeric Lac Repressor with an 11-residue C-terminal Deletion.
4RZT 3.1 Å, Lac repressor engineered to bind sucralose, sucralose-bound tetramer
1LBH 3.2 Å, Intact lactose operon repressor with gratuitous inducer iptg
2PAF 3.5 Å, Crystal Structure of the Lactose Repressor bound to anti-inducer ONPF in induced state

Browse structure collections

About this viewer

MolViewer shows 1LQC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.