1LV9: CXCR3 Binding Chemokine IP-10/CXCL10

CXCR3 Binding Chemokine IP-10/CXCL10. Determined by solution NMR. Released 18 Sept 2002.

Method: Solution NMR
Chains: 1
Atoms: 497
Mol. weight: 8.65 kDa
Released: 18 Sept 2002

Explore 1LV9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LV9 contains 1 α-helix and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 3 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	1
β-strand	39-45	7	1
β-strand	50-54	5	1
α-helix	61-69	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Small inducible cytokine B10	A	protein	77		P02778 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1LV9_1 Small inducible cytokine B10 (chains A)
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA
IKNLLKAVSKEMSKRSP

Primary citation

The CXCR3 binding chemokine IP-10/CXCL10: structure and receptor interactions. Booth, V., Keizer, D.W., Kamphuis, M.B. et al. Biochemistry (2002) 41:10418-10425. DOI 10.1021/bi026020q · PubMed

Other PDB entries of the same protein (UniProt P02778 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1O7Z 1.92 Å, Crystal structure of IP-10 T-form
1O80 2.0 Å, Crystal structure of IP-10 H-Form
1O7Y 3.0 Å, Crystal structure of IP-10 M-form
9P0L 3.1 Å, Composite map of CXCL10-CXCR3-Gi-scFv16
8K2X 3.2 Å, CXCR3-DNGi complex activated by CXCL10

Browse structure collections

About this viewer

MolViewer shows 1LV9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.