1LY2: Unliganded human CD21 SCR1-SCR2

Crystal structure of unliganded human CD21 SCR1-SCR2 (Complement receptor type 2). Determined by X-ray diffraction at 1.8 Å resolution. Released 5 Jul 2002.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,170
Mol. weight: 14.7 kDa
Ligands: NAG
Released: 5 Jul 2002

Explore 1LY2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1LY2 contains 5 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	1
α-helix	5-8	4
β-strand	12-14	3	2
β-strand	21-22	2	1
β-strand	26-28	3	3
β-strand	29-31	3	2
β-strand	35-38	4	4
β-strand	42-44	3	3
β-strand	45-46	2	5
β-strand	54-55	2	5
β-strand	61-64	4	4
α-helix	65	1
β-strand	70-71	2	6
α-helix	72-74	3
β-strand	79-83	5	7
β-strand	88-89	2	6
β-strand	93-98	6	7
α-helix	99	1
β-strand	102-105	4	8
β-strand	109-112	4	7
β-strand	118-119	2	7
α-helix	122-124	3
β-strand	125-128	4	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
complement receptor type 2	A	protein	130	Homo sapiens	P20023 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1LY2_1 complement receptor type 2 (chains A)
EASCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPA
PKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKSVWCQANNMWG
PTRLPTCVSI

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

The crystal structure of human CD21: Implications for Epstein-Barr virus and C3d binding. Prota, A.E., Sage, D.R., Stehle, T. et al. Proc Natl Acad Sci U S A (2002) 99:10641-10646. DOI 10.1073/pnas.162360499 · PubMed

Other PDB entries of the same protein (UniProt P20023 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8SM0 1.68 Å, Crystal structure of human complement receptor 2 (CD21) in complex with Epstein-Barr…
1GHQ 2.04 Å, CR2-C3D complex structure
3OED 3.16 Å, The structure of the complex between complement receptor CR2 and its ligand complement…
8ZNI 3.29 Å, Structure of Epstein-Barr virus major glycoprotein gp350 in complex with the receptor CR2
1W2R Solution structure of CR2 SCR 1-2 by X-ray scattering
1W2S Solution structure of CR2 SCR 1-2 in its complex with C3d by X-ray scattering
2ATY Complement receptor chimaeric conjugate CR2-Ig
2GSX Complement Receptor Type 2

Browse structure collections

About this viewer

MolViewer shows 1LY2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.