1M17: Epidermal growth factor receptor

Epidermal Growth Factor Receptor tyrosine kinase domain with 4-anilinoquinazoline inhibitor erlotinib. Determined by X-ray diffraction at 2.6 Å resolution. Released 4 Sept 2002.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,560
Mol. weight: 38.27 kDa
Ligands: AQ4
Released: 4 Sept 2002

Explore 1M17 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1M17 contains 19 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	678-681	4
β-strand	682	1	1
α-helix	685-687	3
β-strand	688-695	8	1
β-strand	701-707	7	1
β-strand	716-722	7	1
α-helix	727-728	2
α-helix	729-742	14
β-strand	750	1	2
β-strand	753-758	6	1
β-strand	762-767	6	1
β-strand	773	1	2
α-helix	774-779	6
α-helix	782-784	3
α-helix	787-806	20
β-strand	809-810	2	3
α-helix	816-818	3
β-strand	819-823	5	2
β-strand	826-829	4	2
β-strand	836-837	2	3
β-strand	845-846	2	4
α-helix	854-856	3
α-helix	859-864	6
β-strand	866-867	2	4
α-helix	869-884	16
α-helix	888-889	2
α-helix	896-904	9
β-strand	915	1	5
α-helix	917-925	9
α-helix	931-933	3
α-helix	935-936	2
α-helix	937-948	12
α-helix	951-953	3
β-strand	955	1	5
α-helix	989-991	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
epidermal growth factor receptor	A	protein	333	Homo sapiens	P00533 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1M17_1 epidermal growth factor receptor (chains A)
GSHMASGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELRE
ATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNI
GSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEY
HAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEK
GERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHL
PSPTDSNFYRALMDEEDMDDVVDADEYLIPQQG

Ligands and cofactors

ID	Name	Formula	Copies
AQ4	[6,7-BIS(2-methoxy-ethoxy)quinazoline-4-yl]-(3-ethynylphenyl)amine	C22 H23 N3 O4	1

Primary citation

Structure of the epidermal growth factor receptor kinase domain alone and in complex with a 4-anilinoquinazoline inhibitor. Stamos, J., Sliwkowski, M.X., Eigenbrot, C. J Biol Chem (2002) 277:46265-46272. DOI 10.1074/jbc.M207135200 · PubMed

Other PDB entries of the same protein (UniProt P00533 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8A27 1.07 Å, EGFR kinase domain in complex with 2-(6,7-dihydro-5H-pyrrolo[1,2-c]imidazol-1-yl)-2-[6-[2…
8A2D 1.11 Å, EGFR kinase domain (L858R/V948R) in complex with 2-[4-(difluoromethyl)-6-[2-[4-[[4-(hydro…
5UG9 1.33 Å, Crystal structure of the EGFR kinase domain (L858R, T790M, V948R) in complex with a…
5HG8 1.42 Å, EGFR (L858R, T790M, V948R) in complex with N-[3-({2-[(1-methyl-1H-pyrazol-4-yl)amino]-7H-…
8A2A 1.43 Å, EGFR kinase domain in complex with 2-(6,7-dihydro-5H-pyrrolo[1,2-c]imidazol-1-yl)-2-[6-[2…
5UG8 1.46 Å, Crystal structure of the EGFR kinase domain (L858R, T790M, V948R) in complex with a…
3POZ 1.5 Å, EGFR Kinase domain complexed with tak-285
6TFV 1.5 Å, Crystal Structure of EGFR T790M/V948R in Complex with Covalent Pyrrolopyrimidine 18b
6TG0 1.5 Å, Crystal Structure of EGFR T790M/V948R in Complex with Covalent Pyrrolopyrimidine 21a
3VRP 1.52 Å, Crystal structure of the tyrosine kinase binding domain of Cbl-c in complex with…
5HG5 1.52 Å, EGFR (L858R, T790M, V948R) in complex with N-{3-[(2-{[4-(4-methylpiperazin-1-yl)phenyl]am…
5CNO 1.55 Å, Crystal structure of the EGFR kinase domain mutant V924R

Browse more

1M17 is part of these collections:

Kinases and cancer drug targets

About this viewer

MolViewer shows 1M17 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.