1M36: CCHC Zinc Finger from MOZ
Solution Structure of a CCHC Zinc Finger from MOZ. Determined by solution NMR. Released 27 Jan 2004.
- Method
- Solution NMR
- Organism
- Homo sapiens
- Chains
- 1
- Atoms
- 282
- Mol. weight
- 4.11 kDa
- Ligands
- ZN
- Released
- 27 Jan 2004
Explore 1M36 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1M36 contains 1 α-helix and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 1 helix, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 8-9 | 2 | 1 |
| β-strand | 16-17 | 2 | 1 |
| α-helix | 20-29 | 10 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Monocytic leukemia zinc finger protein | A | protein | 33 | Homo sapiens | Q92794 (AlphaFold model) |
Sequence of entity 1 (A), FASTA
>1M36_1 Monocytic leukemia zinc finger protein (chains A)
GSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWF
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| ZN | Zinc ion | Zn | 1 |
Primary citation
Solution Structure of a CCHC Zinc Finger from MOZ. Kwan, A.H.Y., Gell, D.A., Liew, C.K. et al. To be published.
Other PDB entries of the same protein (UniProt Q92794 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5B78 1.4 Å, Crystal structure of MOZ double PHD finger mutant-S210D/N235R in complex with histone H3…
- 3V43 1.47 Å, Crystal structure of MOZ
- 7Y43 1.5 Å, Crystal structure of the KAT6A WH domain and its bound double stranded DNA
- 5B77 1.55 Å, Crystal structrue of MOZ double PHD finger in complex with histone H3 propionylation at…
- 4LK9 1.6 Å, Crystal Structure of MOZ double PHD finger histone H3 tail complex
- 4LKA 1.61 Å, Crystal Structure of MOZ double PHD finger histone H3K9ac complex
- 5B76 1.65 Å, Crystal structure of MOZ double PHD finger domain in complex with histone H3…
- 5B75 1.7 Å, Crystal structure of MOZ double PHD finger in complex with histone H3 butyrylation at K14
- 9DZN 1.72 Å, KAT6A MYST domain complexed with a H3K14-CoA bisubstrate inhibitor
- 8H7A 1.92 Å, Crystal structure of the dimer form KAT6A WH domain with its bound double stranded DNA
- 6LSB 2.0 Å, Crystal Structure of DPF domain of MOZ in complex with H3K14bz peptide
- 9ARR 2.1 Å, Crystal structure of AF9 YEATS domain in complex with dicrotonylated at K1007 and K1014…
Browse structure collections
About this viewer
MolViewer shows 1M36 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.