1M74: Mg-ADP-bound SecA from Bacillus subtilis

Crystal structure of Mg-ADP-bound SecA from Bacillus subtilis. Determined by X-ray diffraction at 3.0 Å resolution. Released 20 Sept 2002.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Bacillus subtilis
Chains: 1
Atoms: 6,501
Mol. weight: 92.33 kDa
Ligands: ADP, MG
Released: 20 Sept 2002

Explore 1M74 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1M74 contains 40 α-helices and 25 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 40 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	4-7	4
α-helix	10-28	19
α-helix	30-34	5
α-helix	38-54	17
α-helix	58-77	20
α-helix	83-93	11
β-strand	97-99	3	1
α-helix	106-118	13
β-strand	124-128	5	1
α-helix	131-147	17
β-strand	152-155	4	1
α-helix	161-169	9
β-strand	172-176	5	1
α-helix	177-186	10
α-helix	193-195	3
β-strand	203-207	5	1
α-helix	209	1
α-helix	210-214	5
α-helix	215-217	3
β-strand	221-225	5	2
α-helix	232-241	10
β-strand	250-251	2	3
β-strand	258-259	2	3
α-helix	263-270	8
α-helix	279-283	5
α-helix	284-297	14
β-strand	306-309	4	4
β-strand	312-315	4	4
β-strand	316-317	2	5
β-strand	322-323	2	5
α-helix	330-332	3
α-helix	333-340	8
α-helix	343-346	4
β-strand	350-355	6	2
α-helix	357-361	5
β-strand	366-371	6	1
α-helix	375-377	3
α-helix	378-384	7
β-strand	389-391	3	1
α-helix	392-394	3
β-strand	401-402	2	6
α-helix	403-405	3
β-strand	406-408	3	7
α-helix	411-426	16
β-strand	432-436	5	6
α-helix	439-451	13
β-strand	457-459	3	6
α-helix	464-472	9
β-strand	480-484	5	6
α-helix	492-494	3
α-helix	499-502	4
β-strand	507-509	3	6
α-helix	516-524	9
β-strand	534-537	4	6
β-strand	538-540	3	7
α-helix	546-548	3
α-helix	552-560	9
β-strand	569	1	7
α-helix	572-618	47
α-helix	624-642	19
α-helix	657-664	8
α-helix	681-703	23
α-helix	707-735	29
α-helix	748-777	30
β-strand	794-797	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Preprotein translocase secA	A	protein	802	Bacillus subtilis	P28366 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1M74_1 Preprotein translocase secA (chains A)
MLGILNKMFDPTKRTLNRYEKIANDIDAIRGDYENLSDDALKHKTIEFKERLEKGATTDD
LLVEAFAVVREASRRVTGMFPFKVQLMGGVALHDGNIAEMKTGEGKTLTSTLPVYLNALT
GKGVHVVTVNEYLASRDAEQMGKIFEFLGLTVGLNLNSMSKDEKREAYAADITYSTNNEL
GFDYLRDNMVLYKEQMVQRPLHFAVIDEVDSILIDEARTPLIISGQAAKSTKLYVQANAF
VRTLKAEKDYTYDIKTKAVQLTEEGMTKAEKAFGIDNLFDVKHVALNHHINQALKAHVAM
QKDVDYVVEDGQVVIVDSFTGRLMKGRRYSEGLHQAIEAKEGLEIQNESMTLATITFQNY
FRMYEKLAGMTGTAKTEEEEFRNIYNMQVVTIPTNRPVVRDDRPDLIYRTMEGKFKAVAE
DVAQRYMTGQPVLVGTVAVETSELISKLLKNKGIPHQVLNAKNHEREAQIIEEAGQKGAV
TIATNMAGRGTDIKLGEGVKELGGLAVVGTERHESRRIDNQLRGRSGRQGDPGITQFYLS
MEDELMRRFGAERTMAMLDRFGMDDSTPIQSKMVSRAVESSQKRVEGNNFDSRKQLLQYD
DVLRQQREVIYKQRFEVIDSENLREIVENMIKSSLERAIAAYTPREELPEEWKLDGLVDL
INTTYLDEGALEKSDIFGKEPDEMLELIMDRIITKYNEKEEQFGKEQMREFEKVIVLRAV
DSKWMDHIDAMDQLRQGIHLRAYAQTNPLREYQMEGFAMFEHMIESIEDEVAKFVMKAEI
ENNLEREEVVQGQTTAHQPQEG

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
MG	Magnesium ion	Mg	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Nucleotide Control of Interdomain Interactions in the Conformational Reaction Cycle of SecA. Hunt, J.F., Weinkauf, S., Henry, L. et al. Science (2002) 297:2018-2026. DOI 10.1126/science.1074424 · PubMed

Other PDB entries of the same protein (UniProt P28366 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1TF5 2.18 Å, Crystal structure of SecA in an open conformation from Bacillus Subtilis
3JV2 2.5 Å, Crystal Structure of B. subtilis SecA with bound peptide
1M6N 2.7 Å, Crystal structure of the SecA translocation ATPase from Bacillus subtilis
1TF2 2.9 Å, Crystal structure of SecA:ADP in an open conformation from Bacillus Subtilis
8YA0 2.97 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+7C)
2IBM 3.2 Å, A novel dimer interface and conformational changes revealed by an X-ray structure of B.…
8Y9Y 3.29 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+1C)
3IQY 3.3 Å, Active site mutants of B. subtilis SecA
7XHB 3.33 Å, Structure of the SecA/SecYE/proOmpA(4Y)-sfGFP complex with ADP
7XHA 3.35 Å, Structure of the SecA/SecYE/proOmpA(4Y)-sfGFP complex with ADP.BeF3-.
3IQM 3.4 Å, Active site mutants of B. subtilis SecA
8Y9Z 3.41 Å, Structure of the SecA-SecY complex with the substrate HmBRI-3TM

Browse structure collections

About this viewer

MolViewer shows 1M74 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.